BLASTX nr result
ID: Aconitum23_contig00014332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00014332 (440 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298458.1| PREDICTED: putative fasciclin-like arabinoga... 97 5e-18 ref|XP_010250718.1| PREDICTED: putative fasciclin-like arabinoga... 96 1e-17 ref|XP_003592555.1| fasciclin-like arabinogalactan protein [Medi... 96 1e-17 ref|XP_004496989.1| PREDICTED: putative fasciclin-like arabinoga... 94 3e-17 gb|KHN06738.1| Putative fasciclin-like arabinogalactan protein 2... 93 7e-17 ref|XP_006589647.1| PREDICTED: putative fasciclin-like arabinoga... 93 7e-17 ref|XP_007143026.1| hypothetical protein PHAVU_007G037300g [Phas... 92 2e-16 ref|XP_014511980.1| PREDICTED: putative fasciclin-like arabinoga... 92 2e-16 gb|KOM28889.1| hypothetical protein LR48_Vigan609s002100 [Vigna ... 92 2e-16 ref|XP_006605951.1| PREDICTED: putative fasciclin-like arabinoga... 89 2e-15 ref|XP_014511979.1| PREDICTED: putative fasciclin-like arabinoga... 88 2e-15 ref|XP_007226654.1| hypothetical protein PRUPE_ppa021895mg [Prun... 86 1e-14 gb|KOM28888.1| hypothetical protein LR48_Vigan609s002000 [Vigna ... 85 2e-14 ref|XP_002280452.1| PREDICTED: putative fasciclin-like arabinoga... 85 2e-14 ref|XP_008243327.1| PREDICTED: putative fasciclin-like arabinoga... 83 7e-14 ref|XP_002534506.1| hypothetical protein RCOM_0377590 [Ricinus c... 80 5e-13 ref|XP_009356296.1| PREDICTED: putative fasciclin-like arabinoga... 80 6e-13 ref|XP_008350997.1| PREDICTED: putative fasciclin-like arabinoga... 80 6e-13 ref|XP_008389993.1| PREDICTED: putative fasciclin-like arabinoga... 80 6e-13 ref|XP_008243340.1| PREDICTED: putative fasciclin-like arabinoga... 80 6e-13 >ref|XP_004298458.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Fragaria vesca subsp. vesca] Length = 338 Score = 97.1 bits (240), Expect = 5e-18 Identities = 44/94 (46%), Positives = 65/94 (69%) Frame = -1 Query: 440 VFRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDR 261 VF RH++PCR+ W+DLVNL+E T+ PT+L G++I I+RSGDV+ NG P+ F ++ GD Sbjct: 242 VFLRHVVPCRLAWSDLVNLTEGTALPTYLDGFTIRISRSGDVLLLNGAPVYFANMYYGDS 301 Query: 260 VVVHGIQKSLDLSTQHVLTGDSISEFQDKSTISD 159 VVVHG+Q+SL + + G+S E ++ D Sbjct: 302 VVVHGLQESL-VMPEEAAAGESSPEEGGSDSLDD 334 >ref|XP_010250718.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Nelumbo nucifera] Length = 347 Score = 95.9 bits (237), Expect = 1e-17 Identities = 42/99 (42%), Positives = 66/99 (66%), Gaps = 2/99 (2%) Frame = -1 Query: 440 VFRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDR 261 VF RH++PCR+TWTDL L + T TF KG++I+IT +GD + NGVP++FP+++ D Sbjct: 246 VFLRHVLPCRLTWTDLTGLDDRTVLQTFSKGFTISITATGDTLMINGVPVIFPDMYYSDW 305 Query: 260 VVVHGIQKSLDLSTQHVLTGDSISEFQ--DKSTISDYGG 150 +V+HG+++ L + TGDS F ++ + D+GG Sbjct: 306 LVIHGLRQMLIFPEKQPPTGDSFFAFNGAEEESTPDFGG 344 >ref|XP_003592555.1| fasciclin-like arabinogalactan protein [Medicago truncatula] gi|355481603|gb|AES62806.1| fasciclin-like arabinogalactan protein [Medicago truncatula] Length = 340 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/93 (49%), Positives = 60/93 (64%) Frame = -1 Query: 437 FRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDRV 258 FRRH++PC+ W DLV+ + T PTFL+G+SINITRSG V+ NGVP+ FP+VF DR+ Sbjct: 242 FRRHVVPCKFLWNDLVDFGDGTQLPTFLEGFSINITRSGGVLILNGVPVFFPDVFFNDRL 301 Query: 257 VVHGIQKSLDLSTQHVLTGDSISEFQDKSTISD 159 VVHG+ L + Q D S D + SD Sbjct: 302 VVHGVTDVLANAVQ-----DDTSAVVDPAVSSD 329 >ref|XP_004496989.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Cicer arietinum] Length = 342 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/93 (47%), Positives = 59/93 (63%) Frame = -1 Query: 437 FRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDRV 258 FRRH++PC+ W DLV+ + + PTFL+G++INITRSG V+ NGVP+ FP++F DRV Sbjct: 244 FRRHVVPCKFLWNDLVDFVDGSELPTFLEGFTINITRSGGVLVLNGVPVFFPDIFFNDRV 303 Query: 257 VVHGIQKSLDLSTQHVLTGDSISEFQDKSTISD 159 VVHG+ L + Q D S D SD Sbjct: 304 VVHGVSDVLAVQVQ-----DDTSAVVDTDFFSD 331 >gb|KHN06738.1| Putative fasciclin-like arabinogalactan protein 20 [Glycine soja] Length = 343 Score = 93.2 bits (230), Expect = 7e-17 Identities = 40/69 (57%), Positives = 51/69 (73%) Frame = -1 Query: 437 FRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDRV 258 FRRH++PCR+ W DLVN + + PTFL G++INITRS V+ NGVP+ FP+VF DRV Sbjct: 247 FRRHVVPCRLLWNDLVNFGDGSELPTFLDGFAINITRSDGVLILNGVPVFFPDVFFNDRV 306 Query: 257 VVHGIQKSL 231 VVHG+ L Sbjct: 307 VVHGVSDVL 315 >ref|XP_006589647.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20-like [Glycine max] gi|947087079|gb|KRH35800.1| hypothetical protein GLYMA_10G265700 [Glycine max] Length = 339 Score = 93.2 bits (230), Expect = 7e-17 Identities = 40/69 (57%), Positives = 51/69 (73%) Frame = -1 Query: 437 FRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDRV 258 FRRH++PCR+ W DLVN + + PTFL G++INITRS V+ NGVP+ FP+VF DRV Sbjct: 240 FRRHVVPCRLLWNDLVNFGDGSELPTFLDGFAINITRSDGVLILNGVPVFFPDVFFNDRV 299 Query: 257 VVHGIQKSL 231 VVHG+ L Sbjct: 300 VVHGVSDVL 308 >ref|XP_007143026.1| hypothetical protein PHAVU_007G037300g [Phaseolus vulgaris] gi|561016216|gb|ESW15020.1| hypothetical protein PHAVU_007G037300g [Phaseolus vulgaris] Length = 326 Score = 92.0 bits (227), Expect = 2e-16 Identities = 38/69 (55%), Positives = 52/69 (75%) Frame = -1 Query: 437 FRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDRV 258 FRRH++PCR+ W DLVN + + +FL+G++INITRSG V+ NGVP+ FP+VF DR+ Sbjct: 232 FRRHVVPCRLLWNDLVNFDDGSELSSFLEGFTINITRSGGVLVFNGVPVFFPDVFFNDRI 291 Query: 257 VVHGIQKSL 231 VVHG+ L Sbjct: 292 VVHGVSNIL 300 >ref|XP_014511980.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Vigna radiata var. radiata] Length = 331 Score = 91.7 bits (226), Expect = 2e-16 Identities = 45/94 (47%), Positives = 59/94 (62%) Frame = -1 Query: 437 FRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDRV 258 FRRH++PCR W DLVN + PTFL G+SINITRS ++ NGVP+ FP++F DRV Sbjct: 237 FRRHVVPCRFLWNDLVNFGDGFLLPTFLDGFSINITRSDGILILNGVPVFFPDLFFNDRV 296 Query: 257 VVHGIQKSLDLSTQHVLTGDSISEFQDKSTISDY 156 VVHG+ L V G++ F D + + DY Sbjct: 297 VVHGVSDIL------VAQGNA---FPDNALVLDY 321 >gb|KOM28889.1| hypothetical protein LR48_Vigan609s002100 [Vigna angularis] Length = 328 Score = 91.7 bits (226), Expect = 2e-16 Identities = 40/69 (57%), Positives = 50/69 (72%) Frame = -1 Query: 437 FRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDRV 258 FRRH++PCR W DLVN + PTFL G+SINITRS V+ NGVP++FP++F DRV Sbjct: 240 FRRHVVPCRFLWNDLVNFGDGFMLPTFLDGFSINITRSDGVLILNGVPVLFPDLFFNDRV 299 Query: 257 VVHGIQKSL 231 VVHG+ L Sbjct: 300 VVHGVSDIL 308 >ref|XP_006605951.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20-like [Glycine max] gi|947041244|gb|KRG90968.1| hypothetical protein GLYMA_20G124900 [Glycine max] Length = 331 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/69 (55%), Positives = 51/69 (73%) Frame = -1 Query: 437 FRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDRV 258 FRRH++PCR+ W DLV+ + + PTFL+G++INITRS V+ NGV + FP+VF DRV Sbjct: 240 FRRHVVPCRLLWNDLVDFGDGSELPTFLEGFAINITRSDGVLILNGVRVFFPDVFFNDRV 299 Query: 257 VVHGIQKSL 231 VVHG+ L Sbjct: 300 VVHGVSDVL 308 >ref|XP_014511979.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Vigna radiata var. radiata] Length = 327 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = -1 Query: 437 FRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRS-GDVMAANGVPIVFPEVFSGDR 261 FRRH++PCR W DLVN + PTFL G++INITRS G V+ NGVP+ FP++F DR Sbjct: 238 FRRHVVPCRFLWNDLVNFGDGFLLPTFLDGFNINITRSDGGVLILNGVPVFFPDIFFNDR 297 Query: 260 VVVHGIQKSL 231 VVVHG+ L Sbjct: 298 VVVHGVSDIL 307 >ref|XP_007226654.1| hypothetical protein PRUPE_ppa021895mg [Prunus persica] gi|462423590|gb|EMJ27853.1| hypothetical protein PRUPE_ppa021895mg [Prunus persica] Length = 342 Score = 85.9 bits (211), Expect = 1e-14 Identities = 34/70 (48%), Positives = 54/70 (77%) Frame = -1 Query: 440 VFRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDR 261 +F RH++PCR+ W+DLV +E T PT+++G++I I+RSGDV+ NGVP+ F ++ D Sbjct: 244 IFLRHVVPCRLLWSDLVRFNEGTVLPTYMEGFTITISRSGDVLLLNGVPVFFANMYYSDS 303 Query: 260 VVVHGIQKSL 231 +VVHG+++SL Sbjct: 304 LVVHGLRESL 313 >gb|KOM28888.1| hypothetical protein LR48_Vigan609s002000 [Vigna angularis] Length = 328 Score = 85.1 bits (209), Expect = 2e-14 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = -1 Query: 437 FRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDRV 258 FRRH++PCR W DL+N + PTFL ++INITRS V+ NG+P+ FP++F DRV Sbjct: 240 FRRHVVPCRFLWNDLMNFGDGFMLPTFLDEFNINITRSDGVLILNGIPVFFPDLFFNDRV 299 Query: 257 VVHGIQKSL 231 VVHG+ L Sbjct: 300 VVHGVSDIL 308 >ref|XP_002280452.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Vitis vinifera] Length = 339 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/85 (44%), Positives = 57/85 (67%) Frame = -1 Query: 440 VFRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDR 261 +F RH++PC+V+W+DLVN + + PT L+G++INITRSGD + N V + FP+++ D Sbjct: 238 IFLRHVLPCKVSWSDLVNFDDGSMLPTSLEGFTINITRSGDTLKLNEVSVAFPDMYHSDW 297 Query: 260 VVVHGIQKSLDLSTQHVLTGDSISE 186 +VVHG+ + L L DS SE Sbjct: 298 LVVHGLGEVLTLLVGPEQAADSSSE 322 >ref|XP_008243327.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Prunus mume] Length = 342 Score = 83.2 bits (204), Expect = 7e-14 Identities = 32/70 (45%), Positives = 54/70 (77%) Frame = -1 Query: 440 VFRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDR 261 +F RH++PCR+ W+DLV ++ T PT+++G++I I+RSGDV+ NGVP+ F ++ + Sbjct: 244 IFLRHVVPCRLLWSDLVRFNDGTVLPTYMEGFTITISRSGDVLLLNGVPVFFANMYYSES 303 Query: 260 VVVHGIQKSL 231 +VVHG+++SL Sbjct: 304 LVVHGLRESL 313 >ref|XP_002534506.1| hypothetical protein RCOM_0377590 [Ricinus communis] gi|223525155|gb|EEF27876.1| hypothetical protein RCOM_0377590 [Ricinus communis] Length = 339 Score = 80.5 bits (197), Expect = 5e-13 Identities = 30/71 (42%), Positives = 52/71 (73%) Frame = -1 Query: 440 VFRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDR 261 +F RH++PC++TW DLV+ + + TFL+G+ I ++RSGD++ N VP+ FP+++ + Sbjct: 248 IFLRHVVPCKITWKDLVDFDDGMVFDTFLEGFGITVSRSGDILMLNEVPVSFPDMYRNEW 307 Query: 260 VVVHGIQKSLD 228 +VVHG++ LD Sbjct: 308 LVVHGLRGMLD 318 >ref|XP_009356296.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Pyrus x bretschneideri] Length = 364 Score = 80.1 bits (196), Expect = 6e-13 Identities = 34/72 (47%), Positives = 53/72 (73%) Frame = -1 Query: 440 VFRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDR 261 +F RH++PCR++W+DLV+L + T T L G+S+NITRS DV+ NGV ++ PEV+ Sbjct: 251 IFHRHVVPCRLSWSDLVSLDDGTVLRTNLVGFSMNITRSDDVLKLNGVSVILPEVYHNGW 310 Query: 260 VVVHGIQKSLDL 225 ++VHGI + L++ Sbjct: 311 LMVHGISEVLEV 322 >ref|XP_008350997.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Malus domestica] Length = 343 Score = 80.1 bits (196), Expect = 6e-13 Identities = 30/70 (42%), Positives = 51/70 (72%) Frame = -1 Query: 440 VFRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDR 261 +F RH++PCR+ W+DL ++ PT+++G++I I+R GDV+ NGVP+ F ++ GD Sbjct: 244 IFLRHVVPCRLMWSDLAGFNDGVVIPTYMQGFAITISRKGDVLLLNGVPVFFANMYYGDT 303 Query: 260 VVVHGIQKSL 231 VVHG++++L Sbjct: 304 FVVHGLRETL 313 >ref|XP_008389993.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Malus domestica] Length = 343 Score = 80.1 bits (196), Expect = 6e-13 Identities = 30/70 (42%), Positives = 51/70 (72%) Frame = -1 Query: 440 VFRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDR 261 +F RH++PCR+ W+DL ++ PT+++G++I I+R GDV+ NGVP+ F ++ GD Sbjct: 244 IFLRHVVPCRLMWSDLAGFNDGVVJPTYMQGFAITISRKGDVLLLNGVPVFFANMYYGDT 303 Query: 260 VVVHGIQKSL 231 VVHG++++L Sbjct: 304 FVVHGLRETL 313 >ref|XP_008243340.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Prunus mume] Length = 361 Score = 80.1 bits (196), Expect = 6e-13 Identities = 34/72 (47%), Positives = 52/72 (72%) Frame = -1 Query: 440 VFRRHMIPCRVTWTDLVNLSEETSYPTFLKGYSINITRSGDVMAANGVPIVFPEVFSGDR 261 +F RH++PCR+ W+DLV+ ++ T T L G++INITRS DV+ NGV ++FPEV+ Sbjct: 248 IFHRHVVPCRLLWSDLVSFNDGTVLRTNLMGFTINITRSQDVLMLNGVSVIFPEVYHNGW 307 Query: 260 VVVHGIQKSLDL 225 + VHGI + L++ Sbjct: 308 LAVHGISEVLEV 319