BLASTX nr result
ID: Aconitum23_contig00014264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00014264 (511 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011001515.1| PREDICTED: thioredoxin domain-containing pro... 76 9e-12 ref|XP_010271635.1| PREDICTED: thioredoxin domain-containing pro... 75 2e-11 ref|XP_009599692.1| PREDICTED: thioredoxin domain-containing pro... 74 3e-11 ref|XP_009776292.1| PREDICTED: thioredoxin domain-containing pro... 74 4e-11 ref|XP_012093074.1| PREDICTED: thioredoxin domain-containing pro... 74 4e-11 ref|XP_002518645.1| Thioredoxin domain-containing protein, putat... 74 4e-11 ref|XP_006486959.1| PREDICTED: thioredoxin domain-containing pro... 74 4e-11 ref|XP_006422869.1| hypothetical protein CICLE_v10029279mg [Citr... 74 4e-11 ref|XP_007042575.1| Thioredoxin domain-containing protein 9 [The... 74 4e-11 ref|XP_002313888.1| hypothetical protein POPTR_0009s09570g [Popu... 74 6e-11 ref|XP_010099065.1| Thioredoxin domain-containing protein 9-like... 73 7e-11 ref|XP_009396930.1| PREDICTED: thioredoxin domain-containing pro... 73 7e-11 ref|XP_010065941.1| PREDICTED: thioredoxin domain-containing pro... 73 7e-11 ref|XP_003573612.1| PREDICTED: thioredoxin domain-containing pro... 73 7e-11 ref|XP_014512205.1| PREDICTED: thioredoxin domain-containing pro... 73 1e-10 emb|CDO97246.1| unnamed protein product [Coffea canephora] 73 1e-10 ref|XP_007143085.1| hypothetical protein PHAVU_007G042300g [Phas... 73 1e-10 ref|XP_002300249.2| hypothetical protein POPTR_0001s30520g [Popu... 73 1e-10 gb|KQL01160.1| hypothetical protein SETIT_015157mg, partial [Set... 72 1e-10 ref|XP_011030376.1| PREDICTED: thioredoxin domain-containing pro... 72 1e-10 >ref|XP_011001515.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Populus euphratica] Length = 213 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSPFLAEKLKILVLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKIHAEKSPFLAEKLKILVLPTLALIKNAKVDDYVVG 155 >ref|XP_010271635.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Nelumbo nucifera] Length = 213 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSPFLAEKLKI+VLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKIHAEKSPFLAEKLKIVVLPTLALIKNAKVDDYVVG 155 >ref|XP_009599692.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Nicotiana tomentosiformis] Length = 210 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSP+LAEKL+I+VLPTLALVKNAKVEDYVVG Sbjct: 117 RFVKIHAEKSPYLAEKLRIVVLPTLALVKNAKVEDYVVG 155 >ref|XP_009776292.1| PREDICTED: thioredoxin domain-containing protein 9 homolog isoform X1 [Nicotiana sylvestris] gi|698576720|ref|XP_009776293.1| PREDICTED: thioredoxin domain-containing protein 9 homolog isoform X2 [Nicotiana sylvestris] Length = 210 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSP+LAEKL+++VLPTLALVKNAKVEDYVVG Sbjct: 117 RFVKIHAEKSPYLAEKLRVVVLPTLALVKNAKVEDYVVG 155 >ref|XP_012093074.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Jatropha curcas] gi|643738533|gb|KDP44454.1| hypothetical protein JCGZ_16287 [Jatropha curcas] Length = 213 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSPFLAE+LKI+VLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKIHAEKSPFLAERLKIVVLPTLALIKNAKVDDYVVG 155 >ref|XP_002518645.1| Thioredoxin domain-containing protein, putative [Ricinus communis] gi|223542026|gb|EEF43570.1| Thioredoxin domain-containing protein, putative [Ricinus communis] Length = 209 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSPFLAE+LKI+VLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKIHAEKSPFLAERLKIVVLPTLALIKNAKVDDYVVG 155 >ref|XP_006486959.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Citrus sinensis] gi|641828792|gb|KDO47930.1| hypothetical protein CISIN_1g028334mg [Citrus sinensis] Length = 210 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSPFLAE+LKI+VLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKIHAEKSPFLAERLKIVVLPTLALIKNAKVDDYVVG 155 >ref|XP_006422869.1| hypothetical protein CICLE_v10029279mg [Citrus clementina] gi|557524803|gb|ESR36109.1| hypothetical protein CICLE_v10029279mg [Citrus clementina] Length = 210 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSPFLAE+LKI+VLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKIHAEKSPFLAERLKIVVLPTLALIKNAKVDDYVVG 155 >ref|XP_007042575.1| Thioredoxin domain-containing protein 9 [Theobroma cacao] gi|508706510|gb|EOX98406.1| Thioredoxin domain-containing protein 9 [Theobroma cacao] Length = 213 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSPFLAE+LKI+VLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKIHAEKSPFLAERLKIVVLPTLALIKNAKVDDYVVG 155 >ref|XP_002313888.1| hypothetical protein POPTR_0009s09570g [Populus trichocarpa] gi|118484130|gb|ABK93948.1| unknown [Populus trichocarpa] gi|222850296|gb|EEE87843.1| hypothetical protein POPTR_0009s09570g [Populus trichocarpa] Length = 213 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKI+AEKSPFLAEKLKILVLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKINAEKSPFLAEKLKILVLPTLALIKNAKVDDYVVG 155 >ref|XP_010099065.1| Thioredoxin domain-containing protein 9-like protein [Morus notabilis] gi|587887931|gb|EXB76654.1| Thioredoxin domain-containing protein 9-like protein [Morus notabilis] Length = 213 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSPFLAEKLKI+VLPT+AL+KN+KV+DYVVG Sbjct: 117 RFVKIHAEKSPFLAEKLKIVVLPTIALIKNSKVDDYVVG 155 >ref|XP_009396930.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Musa acuminata subsp. malaccensis] Length = 211 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RF+KIHAEKSPFL EKL+I+VLPTLALVKNAKVEDYVVG Sbjct: 116 RFLKIHAEKSPFLTEKLRIIVLPTLALVKNAKVEDYVVG 154 >ref|XP_010065941.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Eucalyptus grandis] gi|629097891|gb|KCW63656.1| hypothetical protein EUGRSUZ_G01295 [Eucalyptus grandis] Length = 212 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKI AEKSPFLAEKLKI+VLPTLAL+KNAKVEDYVVG Sbjct: 117 RFVKIQAEKSPFLAEKLKIVVLPTLALIKNAKVEDYVVG 155 >ref|XP_003573612.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Brachypodium distachyon] gi|944060207|gb|KQJ95797.1| hypothetical protein BRADI_3g19070 [Brachypodium distachyon] Length = 211 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RF+K+HAEKSPFL EKL+I+VLPTLALVKNAKVEDYVVG Sbjct: 115 RFIKVHAEKSPFLTEKLRIVVLPTLALVKNAKVEDYVVG 153 >ref|XP_014512205.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Vigna radiata var. radiata] Length = 213 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKI+AEKSPFLAEKLKI+VLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKINAEKSPFLAEKLKIIVLPTLALIKNAKVDDYVVG 155 >emb|CDO97246.1| unnamed protein product [Coffea canephora] Length = 213 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSP+LAEKL+I+VLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKIHAEKSPYLAEKLRIVVLPTLALIKNAKVDDYVVG 155 >ref|XP_007143085.1| hypothetical protein PHAVU_007G042300g [Phaseolus vulgaris] gi|561016275|gb|ESW15079.1| hypothetical protein PHAVU_007G042300g [Phaseolus vulgaris] Length = 213 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKI+AEKSPFLAEKLKI+VLPTLAL+KNAKV+DYVVG Sbjct: 117 RFVKINAEKSPFLAEKLKIIVLPTLALIKNAKVDDYVVG 155 >ref|XP_002300249.2| hypothetical protein POPTR_0001s30520g [Populus trichocarpa] gi|550348555|gb|EEE85054.2| hypothetical protein POPTR_0001s30520g [Populus trichocarpa] Length = 212 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSPF+AEKLKI+VLPTLAL+KN KV+DYVVG Sbjct: 117 RFVKIHAEKSPFMAEKLKIVVLPTLALIKNTKVDDYVVG 155 >gb|KQL01160.1| hypothetical protein SETIT_015157mg, partial [Setaria italica] Length = 114 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RF+K+HAEK+PFL EKLKI+VLPTLA+VKNAKVEDYVVG Sbjct: 17 RFIKVHAEKAPFLTEKLKIVVLPTLAIVKNAKVEDYVVG 55 >ref|XP_011030376.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Populus euphratica] Length = 212 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -1 Query: 511 RFVKIHAEKSPFLAEKLKILVLPTLALVKNAKVEDYVVG 395 RFVKIHAEKSPFLAEKL+I+VLPTLAL+KN KV+DYVVG Sbjct: 117 RFVKIHAEKSPFLAEKLRIVVLPTLALIKNTKVDDYVVG 155