BLASTX nr result
ID: Aconitum23_contig00014131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00014131 (369 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008439963.1| PREDICTED: probable dolichyl-diphosphooligos... 73 1e-10 ref|XP_004134751.1| PREDICTED: probable dolichyl-diphosphooligos... 73 1e-10 ref|XP_012445402.1| PREDICTED: probable dolichyl-diphosphooligos... 71 3e-10 ref|XP_006467991.1| PREDICTED: probable dolichyl-diphosphooligos... 71 4e-10 ref|XP_006449087.1| hypothetical protein CICLE_v10015811mg [Citr... 71 4e-10 ref|XP_008224787.1| PREDICTED: probable dolichyl-diphosphooligos... 70 6e-10 ref|XP_007211522.1| hypothetical protein PRUPE_ppa008096mg [Prun... 70 6e-10 ref|XP_012842000.1| PREDICTED: probable dolichyl-diphosphooligos... 70 8e-10 ref|XP_010057975.1| PREDICTED: probable dolichyl-diphosphooligos... 69 1e-09 gb|KNA09977.1| hypothetical protein SOVF_148670 [Spinacia oleracea] 69 1e-09 ref|XP_010240915.1| PREDICTED: probable dolichyl-diphosphooligos... 69 1e-09 ref|XP_010267747.1| PREDICTED: probable dolichyl-diphosphooligos... 69 1e-09 ref|XP_009589960.1| PREDICTED: probable dolichyl-diphosphooligos... 69 2e-09 ref|XP_011086172.1| PREDICTED: probable dolichyl-diphosphooligos... 68 2e-09 ref|XP_009769271.1| PREDICTED: probable dolichyl-diphosphooligos... 68 2e-09 ref|XP_009799167.1| PREDICTED: probable dolichyl-diphosphooligos... 68 2e-09 ref|XP_009607322.1| PREDICTED: probable dolichyl-diphosphooligos... 68 2e-09 ref|XP_007025995.1| Tumor suppressor candidate, putative isoform... 68 2e-09 dbj|BAD43864.1| hypothetical protein [Arabidopsis thaliana] 68 3e-09 ref|XP_010533832.1| PREDICTED: probable dolichyl-diphosphooligos... 68 3e-09 >ref|XP_008439963.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Cucumis melo] Length = 344 Score = 72.8 bits (177), Expect = 1e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 L +SFWAVKKVVYLDNWKTGY IHGYWPSSWN Sbjct: 313 LFVSFWAVKKVVYLDNWKTGYGIHGYWPSSWN 344 >ref|XP_004134751.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Cucumis sativus] gi|700193925|gb|KGN49129.1| hypothetical protein Csa_6G514900 [Cucumis sativus] Length = 344 Score = 72.8 bits (177), Expect = 1e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 L +SFWAVKKVVYLDNWKTGY IHGYWPSSWN Sbjct: 313 LFVSFWAVKKVVYLDNWKTGYGIHGYWPSSWN 344 >ref|XP_012445402.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Gossypium raimondii] Length = 339 Score = 71.2 bits (173), Expect = 3e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 369 TLLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 TLL+SFWAVKKV+ LDNWKTGY IHG+WPSSWN Sbjct: 307 TLLVSFWAVKKVILLDNWKTGYGIHGFWPSSWN 339 >ref|XP_006467991.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B-like [Citrus sinensis] gi|641856772|gb|KDO75538.1| hypothetical protein CISIN_1g048343mg [Citrus sinensis] Length = 347 Score = 70.9 bits (172), Expect = 4e-10 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 369 TLLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 +LL+SFWAV KV+YLDNWKTGY +HG+WPSSWN Sbjct: 315 SLLISFWAVNKVIYLDNWKTGYGVHGFWPSSWN 347 >ref|XP_006449087.1| hypothetical protein CICLE_v10015811mg [Citrus clementina] gi|557551698|gb|ESR62327.1| hypothetical protein CICLE_v10015811mg [Citrus clementina] Length = 347 Score = 70.9 bits (172), Expect = 4e-10 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 369 TLLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 +LL+SFWAV KV+YLDNWKTGY +HG+WPSSWN Sbjct: 315 SLLISFWAVNKVIYLDNWKTGYGVHGFWPSSWN 347 >ref|XP_008224787.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Prunus mume] Length = 345 Score = 70.1 bits (170), Expect = 6e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 LL+SFWAVKKVVYLDNWKTGY +H +WPSSWN Sbjct: 314 LLVSFWAVKKVVYLDNWKTGYGVHAFWPSSWN 345 >ref|XP_007211522.1| hypothetical protein PRUPE_ppa008096mg [Prunus persica] gi|462407387|gb|EMJ12721.1| hypothetical protein PRUPE_ppa008096mg [Prunus persica] Length = 345 Score = 70.1 bits (170), Expect = 6e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 LL+SFWAVKKVVYLDNWKTGY +H +WPSSWN Sbjct: 314 LLVSFWAVKKVVYLDNWKTGYGVHAFWPSSWN 345 >ref|XP_012842000.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Erythranthe guttatus] gi|604328241|gb|EYU33909.1| hypothetical protein MIMGU_mgv1a027011mg [Erythranthe guttata] Length = 348 Score = 69.7 bits (169), Expect = 8e-10 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSW 274 L++SFWAVKKVV+LDNWKTGY IHGYWPSSW Sbjct: 318 LIVSFWAVKKVVFLDNWKTGYGIHGYWPSSW 348 >ref|XP_010057975.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Eucalyptus grandis] gi|629110221|gb|KCW75367.1| hypothetical protein EUGRSUZ_E04113 [Eucalyptus grandis] Length = 342 Score = 69.3 bits (168), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 LLL FWAVKKVV+LDNWKTGY IHG+WP+SWN Sbjct: 311 LLLCFWAVKKVVFLDNWKTGYGIHGFWPNSWN 342 >gb|KNA09977.1| hypothetical protein SOVF_148670 [Spinacia oleracea] Length = 346 Score = 68.9 bits (167), Expect = 1e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSW 274 L++SFWAVKKVVYLDNWKTGY IH YWPSSW Sbjct: 316 LIVSFWAVKKVVYLDNWKTGYGIHAYWPSSW 346 >ref|XP_010240915.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Nelumbo nucifera] Length = 345 Score = 68.9 bits (167), Expect = 1e-09 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSW 274 LL+SFWAVKKV+YLDNWKTGY IHG+WP+SW Sbjct: 314 LLVSFWAVKKVIYLDNWKTGYGIHGFWPNSW 344 >ref|XP_010267747.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Nelumbo nucifera] Length = 345 Score = 68.9 bits (167), Expect = 1e-09 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 369 TLLLSFWAVKKVVYLDNWKTGYAIHGYWPSSW 274 TLL+SFWAVK+V+YLDNWKTGY IHG+WP+SW Sbjct: 313 TLLVSFWAVKEVIYLDNWKTGYRIHGFWPNSW 344 >ref|XP_009589960.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Nicotiana tomentosiformis] Length = 357 Score = 68.6 bits (166), Expect = 2e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSW 274 L++SFWAVKKV+YLDNWKTGY IH YWPSSW Sbjct: 326 LIVSFWAVKKVIYLDNWKTGYGIHAYWPSSW 356 >ref|XP_011086172.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Sesamum indicum] Length = 343 Score = 68.2 bits (165), Expect = 2e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSW 274 + +SFWAVKKVV+LDNWKTGY IHGYWPSSW Sbjct: 312 MFVSFWAVKKVVFLDNWKTGYGIHGYWPSSW 342 >ref|XP_009769271.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Nicotiana sylvestris] Length = 344 Score = 68.2 bits (165), Expect = 2e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSW 274 L++SFWAVKKV+YLDNWKTGY +H YWPSSW Sbjct: 313 LIVSFWAVKKVIYLDNWKTGYGVHAYWPSSW 343 >ref|XP_009799167.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Nicotiana sylvestris] Length = 344 Score = 68.2 bits (165), Expect = 2e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 L +SFWAVKKV++LDNWKTGY IH YWPSSWN Sbjct: 313 LFVSFWAVKKVIHLDNWKTGYGIHAYWPSSWN 344 >ref|XP_009607322.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Nicotiana tomentosiformis] Length = 344 Score = 68.2 bits (165), Expect = 2e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 L +SFWAVKKV++LDNWKTGY IH YWPSSWN Sbjct: 313 LFVSFWAVKKVIHLDNWKTGYGIHAYWPSSWN 344 >ref|XP_007025995.1| Tumor suppressor candidate, putative isoform 1 [Theobroma cacao] gi|508781361|gb|EOY28617.1| Tumor suppressor candidate, putative isoform 1 [Theobroma cacao] Length = 342 Score = 68.2 bits (165), Expect = 2e-09 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 + +SFWAVKKV++LDNWKTGY +HG+WPSSWN Sbjct: 311 IFVSFWAVKKVIFLDNWKTGYGVHGFWPSSWN 342 >dbj|BAD43864.1| hypothetical protein [Arabidopsis thaliana] Length = 38 Score = 67.8 bits (164), Expect = 3e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSW 274 L +SFWAVKKVVYLDNWKTGY IH YWPSSW Sbjct: 7 LFISFWAVKKVVYLDNWKTGYGIHPYWPSSW 37 >ref|XP_010533832.1| PREDICTED: probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B [Tarenaya hassleriana] Length = 346 Score = 67.8 bits (164), Expect = 3e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 366 LLLSFWAVKKVVYLDNWKTGYAIHGYWPSSWN 271 L +SFWAVKKV+YLDNWKTGY IH YWPSSW+ Sbjct: 315 LFISFWAVKKVIYLDNWKTGYGIHPYWPSSWH 346