BLASTX nr result
ID: Aconitum23_contig00013761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00013761 (1600 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011002600.1| PREDICTED: B3 domain-containing transcriptio... 60 6e-06 ref|XP_011019010.1| PREDICTED: B3 domain-containing transcriptio... 60 6e-06 ref|XP_011019009.1| PREDICTED: B3 domain-containing transcriptio... 60 6e-06 ref|XP_002323669.1| hypothetical protein POPTR_0016s14350g [Popu... 60 6e-06 ref|XP_002309182.2| hypothetical protein POPTR_0006s10880g [Popu... 60 6e-06 ref|XP_011466419.1| PREDICTED: B3 domain-containing transcriptio... 60 7e-06 ref|XP_004302530.1| PREDICTED: B3 domain-containing transcriptio... 60 7e-06 >ref|XP_011002600.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like [Populus euphratica] gi|743917234|ref|XP_011002602.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like [Populus euphratica] Length = 917 Score = 60.1 bits (144), Expect = 6e-06 Identities = 34/52 (65%), Positives = 36/52 (69%), Gaps = 7/52 (13%) Frame = +1 Query: 775 RSPIDGRGRN------CPRVTDQELQQISGDPNSTIVPLFE-VFMFGDNGLI 909 R P +GRGRN PR+TDQELQQISGDPNSTIVPLFE V D G I Sbjct: 288 RPPAEGRGRNQLLPRYWPRITDQELQQISGDPNSTIVPLFEKVLSASDAGRI 339 >ref|XP_011019010.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X2 [Populus euphratica] Length = 885 Score = 60.1 bits (144), Expect = 6e-06 Identities = 34/52 (65%), Positives = 36/52 (69%), Gaps = 7/52 (13%) Frame = +1 Query: 775 RSPIDGRGRN------CPRVTDQELQQISGDPNSTIVPLFE-VFMFGDNGLI 909 R P +GRGRN PR+TDQELQQISGDPNSTIVPLFE V D G I Sbjct: 291 RPPAEGRGRNQLLPRYWPRITDQELQQISGDPNSTIVPLFEKVLSASDAGRI 342 >ref|XP_011019009.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X1 [Populus euphratica] Length = 921 Score = 60.1 bits (144), Expect = 6e-06 Identities = 34/52 (65%), Positives = 36/52 (69%), Gaps = 7/52 (13%) Frame = +1 Query: 775 RSPIDGRGRN------CPRVTDQELQQISGDPNSTIVPLFE-VFMFGDNGLI 909 R P +GRGRN PR+TDQELQQISGDPNSTIVPLFE V D G I Sbjct: 291 RPPAEGRGRNQLLPRYWPRITDQELQQISGDPNSTIVPLFEKVLSASDAGRI 342 >ref|XP_002323669.1| hypothetical protein POPTR_0016s14350g [Populus trichocarpa] gi|222868299|gb|EEF05430.1| hypothetical protein POPTR_0016s14350g [Populus trichocarpa] Length = 917 Score = 60.1 bits (144), Expect = 6e-06 Identities = 34/52 (65%), Positives = 36/52 (69%), Gaps = 7/52 (13%) Frame = +1 Query: 775 RSPIDGRGRN------CPRVTDQELQQISGDPNSTIVPLFE-VFMFGDNGLI 909 R P +GRGRN PR+TDQELQQISGDPNSTIVPLFE V D G I Sbjct: 288 RPPAEGRGRNQLLPRYWPRITDQELQQISGDPNSTIVPLFEKVLSASDAGRI 339 >ref|XP_002309182.2| hypothetical protein POPTR_0006s10880g [Populus trichocarpa] gi|550335943|gb|EEE92705.2| hypothetical protein POPTR_0006s10880g [Populus trichocarpa] Length = 880 Score = 60.1 bits (144), Expect = 6e-06 Identities = 34/52 (65%), Positives = 36/52 (69%), Gaps = 7/52 (13%) Frame = +1 Query: 775 RSPIDGRGRN------CPRVTDQELQQISGDPNSTIVPLFE-VFMFGDNGLI 909 R P +GRGRN PR+TDQELQQISGDPNSTIVPLFE V D G I Sbjct: 249 RPPAEGRGRNQLLPRYWPRITDQELQQISGDPNSTIVPLFEKVLSASDAGRI 300 >ref|XP_011466419.1| PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X2 [Fragaria vesca subsp. vesca] Length = 871 Score = 59.7 bits (143), Expect = 7e-06 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 6/41 (14%) Frame = +1 Query: 775 RSPIDGRGRN------CPRVTDQELQQISGDPNSTIVPLFE 879 R P +GRGRN PR+TDQELQQISGDPNSTIVPLFE Sbjct: 285 RPPAEGRGRNQLLPRYWPRITDQELQQISGDPNSTIVPLFE 325 >ref|XP_004302530.1| PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X1 [Fragaria vesca subsp. vesca] Length = 907 Score = 59.7 bits (143), Expect = 7e-06 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 6/41 (14%) Frame = +1 Query: 775 RSPIDGRGRN------CPRVTDQELQQISGDPNSTIVPLFE 879 R P +GRGRN PR+TDQELQQISGDPNSTIVPLFE Sbjct: 285 RPPAEGRGRNQLLPRYWPRITDQELQQISGDPNSTIVPLFE 325