BLASTX nr result
ID: Aconitum23_contig00013235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00013235 (323 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus ... 61 4e-07 ref|XP_012441953.1| PREDICTED: F-box protein At2g39490-like [Gos... 60 8e-07 gb|KMS95076.1| hypothetical protein BVRB_012730 isoform B [Beta ... 59 1e-06 gb|KMS95075.1| hypothetical protein BVRB_012730 isoform A [Beta ... 59 1e-06 ref|XP_012837182.1| PREDICTED: F-box/LRR-repeat protein At3g2692... 59 1e-06 gb|KJB60671.1| hypothetical protein B456_009G318500 [Gossypium r... 59 1e-06 ref|XP_010667859.1| PREDICTED: putative F-box/LRR-repeat protein... 59 1e-06 ref|XP_010667857.1| PREDICTED: putative F-box/LRR-repeat protein... 59 1e-06 ref|XP_010667856.1| PREDICTED: putative F-box/LRR-repeat protein... 59 1e-06 ref|XP_008242821.1| PREDICTED: F-box/LRR-repeat protein 25-like ... 59 1e-06 ref|XP_010658617.1| PREDICTED: F-box protein At2g39490-like isof... 59 1e-06 ref|XP_012851879.1| PREDICTED: F-box/LRR-repeat protein At3g2692... 59 1e-06 ref|XP_006421498.1| hypothetical protein CICLE_v10007166mg, part... 59 1e-06 ref|XP_008656407.1| PREDICTED: putative F-box/LRR-repeat protein... 59 2e-06 ref|XP_007204135.1| hypothetical protein PRUPE_ppa023344mg, part... 59 2e-06 ref|XP_012851087.1| PREDICTED: F-box/LRR-repeat protein At3g2692... 58 2e-06 gb|KDO57272.1| hypothetical protein CISIN_1g042431mg, partial [C... 58 3e-06 ref|XP_012852946.1| PREDICTED: F-box/LRR-repeat protein At3g2692... 58 3e-06 emb|CDP07614.1| unnamed protein product [Coffea canephora] 57 4e-06 emb|CDP07607.1| unnamed protein product [Coffea canephora] 57 4e-06 >ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 464 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/71 (45%), Positives = 44/71 (61%) Frame = -3 Query: 222 NYFRNQKPKIPFSTNTIKGDDKKTIEDHISKLPKDILHFIISILTMREGARTSILSTRWR 43 N Q +P N + + I +HIS+LP+D+L I+S LTM+E ARTSILSTRWR Sbjct: 10 NSGEGQNSLLPSDENRARNGN---ISEHISQLPEDVLLNILSRLTMKEAARTSILSTRWR 66 Query: 42 NLWSESLSCLD 10 +LW+ +D Sbjct: 67 HLWTYYTGIMD 77 >ref|XP_012441953.1| PREDICTED: F-box protein At2g39490-like [Gossypium raimondii] Length = 563 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/57 (49%), Positives = 37/57 (64%) Frame = -3 Query: 192 PFSTNTIKGDDKKTIEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESL 22 P++ I +K D+IS+LP +ILH IIS L G RTSILST W++LW E+L Sbjct: 62 PYNHVNIPKSNKMDPNDYISRLPDNILHHIISFLPFESGVRTSILSTHWKHLWKEAL 118 >gb|KMS95076.1| hypothetical protein BVRB_012730 isoform B [Beta vulgaris subsp. vulgaris] Length = 355 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -3 Query: 144 DHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLDLHY 1 D +S+LP D+L I+S L ++E RTS+LS RWRNLW+ + LD HY Sbjct: 57 DRLSELPDDVLVLILSRLRLKEAVRTSVLSPRWRNLWTYTTGTLDFHY 104 >gb|KMS95075.1| hypothetical protein BVRB_012730 isoform A [Beta vulgaris subsp. vulgaris] Length = 356 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -3 Query: 144 DHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLDLHY 1 D +S+LP D+L I+S L ++E RTS+LS RWRNLW+ + LD HY Sbjct: 58 DRLSELPDDVLVLILSRLRLKEAVRTSVLSPRWRNLWTYTTGTLDFHY 105 >ref|XP_012837182.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Erythranthe guttatus] Length = 463 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/54 (51%), Positives = 40/54 (74%) Frame = -3 Query: 180 NTIKGDDKKTIEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLS 19 +T+ DD +D IS+L DIL +I+S+L+++E ARTS+LSTRWRNLW + S Sbjct: 21 STVGSDD----DDRISRLSDDILVYILSLLSLKESARTSLLSTRWRNLWKHTPS 70 >gb|KJB60671.1| hypothetical protein B456_009G318500 [Gossypium raimondii] Length = 524 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = -3 Query: 183 TNTIKGDDKKTIEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESL 22 T T +K D+IS+LP +ILH IIS L G RTSILST W++LW E+L Sbjct: 26 TTTSISSNKMDPNDYISRLPDNILHHIISFLPFESGVRTSILSTHWKHLWKEAL 79 >ref|XP_010667859.1| PREDICTED: putative F-box/LRR-repeat protein At3g59160 isoform X3 [Beta vulgaris subsp. vulgaris] gi|731377395|ref|XP_010667860.1| PREDICTED: putative F-box/LRR-repeat protein At3g59160 isoform X3 [Beta vulgaris subsp. vulgaris] gi|870841226|gb|KMS95077.1| hypothetical protein BVRB_012730 isoform C [Beta vulgaris subsp. vulgaris] Length = 328 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -3 Query: 144 DHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLDLHY 1 D +S+LP D+L I+S L ++E RTS+LS RWRNLW+ + LD HY Sbjct: 30 DRLSELPDDVLVLILSRLRLKEAVRTSVLSPRWRNLWTYTTGTLDFHY 77 >ref|XP_010667857.1| PREDICTED: putative F-box/LRR-repeat protein At3g59160 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 366 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -3 Query: 144 DHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLDLHY 1 D +S+LP D+L I+S L ++E RTS+LS RWRNLW+ + LD HY Sbjct: 68 DRLSELPDDVLVLILSRLRLKEAVRTSVLSPRWRNLWTYTTGTLDFHY 115 >ref|XP_010667856.1| PREDICTED: putative F-box/LRR-repeat protein At3g59160 isoform X1 [Beta vulgaris subsp. vulgaris] Length = 367 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -3 Query: 144 DHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLDLHY 1 D +S+LP D+L I+S L ++E RTS+LS RWRNLW+ + LD HY Sbjct: 69 DRLSELPDDVLVLILSRLRLKEAVRTSVLSPRWRNLWTYTTGTLDFHY 116 >ref|XP_008242821.1| PREDICTED: F-box/LRR-repeat protein 25-like [Prunus mume] Length = 310 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/43 (53%), Positives = 36/43 (83%) Frame = -3 Query: 159 KKTIEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWS 31 ++ +DHISKLP D+LH I+S+L+MR+ RTS+LS RW+N+++ Sbjct: 2 RRKCKDHISKLPDDVLHTIVSLLSMRDAVRTSVLSHRWKNMYA 44 >ref|XP_010658617.1| PREDICTED: F-box protein At2g39490-like isoform X1 [Vitis vinifera] gi|296086280|emb|CBI31721.3| unnamed protein product [Vitis vinifera] Length = 471 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/68 (44%), Positives = 46/68 (67%) Frame = -3 Query: 225 RNYFRNQKPKIPFSTNTIKGDDKKTIEDHISKLPKDILHFIISILTMREGARTSILSTRW 46 ++ F ++ P + + N++ + ED IS+LP +IL IIS+L R A+TS+LSTRW Sbjct: 29 KSCFNSENPNLTRNRNSVVEE-----EDLISRLPDEILLRIISLLPTRSAAQTSLLSTRW 83 Query: 45 RNLWSESL 22 RNLWS++L Sbjct: 84 RNLWSKAL 91 >ref|XP_012851879.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Erythranthe guttatus] gi|604306517|gb|EYU25320.1| hypothetical protein MIMGU_mgv1a006232mg [Erythranthe guttata] Length = 451 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = -3 Query: 189 FSTNTIKGDDKKTIEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLS 19 F T GDD D IS+LP DIL I+S+L+++E AR SILS+RW NLW +LS Sbjct: 12 FQPKTCVGDD-----DRISQLPDDILVVILSLLSLKEAARASILSSRWTNLWKHTLS 63 >ref|XP_006421498.1| hypothetical protein CICLE_v10007166mg, partial [Citrus clementina] gi|557523371|gb|ESR34738.1| hypothetical protein CICLE_v10007166mg, partial [Citrus clementina] Length = 382 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -3 Query: 162 DKKTIEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLDLH 4 +K ED ISKLP DIL I+S LT++E A+TSIL++RWR LW+ CLD + Sbjct: 13 EKMAPEDGISKLPDDILICILSRLTIKEAAKTSILASRWRYLWTFFSGCLDFN 65 >ref|XP_008656407.1| PREDICTED: putative F-box/LRR-repeat protein At3g58880 [Zea mays] Length = 430 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = -3 Query: 165 DDKKTIEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLDLH 4 D+++ + D IS LP D+L I+S+L R GART +LS+RWR++W + +DLH Sbjct: 15 DEEQRLADRISSLPDDVLGEIVSLLPTRAGARTQVLSSRWRHIWRSAPLNMDLH 68 >ref|XP_007204135.1| hypothetical protein PRUPE_ppa023344mg, partial [Prunus persica] gi|462399666|gb|EMJ05334.1| hypothetical protein PRUPE_ppa023344mg, partial [Prunus persica] Length = 479 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = -3 Query: 174 IKGDDKKTIEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSES 25 IK DD K +ED IS+LP +++ I+S+L +RE TSILS RWR +WS + Sbjct: 16 IKDDDHKVVEDRISELPYEVVVSIVSLLPLREAVATSILSRRWRYVWSST 65 >ref|XP_012851087.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Erythranthe guttatus] gi|604311817|gb|EYU25811.1| hypothetical protein MIMGU_mgv11b018114mg [Erythranthe guttata] Length = 421 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/48 (54%), Positives = 39/48 (81%) Frame = -3 Query: 150 IEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLDL 7 ++D IS+LP D+L I+S L+++E ARTS+LS+RW NLW + ++CLDL Sbjct: 5 VDDRISQLPDDVLVDILSFLSLKEAARTSVLSSRWINLW-KHITCLDL 51 >gb|KDO57272.1| hypothetical protein CISIN_1g042431mg, partial [Citrus sinensis] Length = 302 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -3 Query: 147 EDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLDLH 4 ED ISKLP DIL I+S LT++E A+TSIL++RWR LW+ CLD + Sbjct: 4 EDGISKLPDDILICILSRLTIKEAAKTSILASRWRYLWTFFSGCLDFN 51 >ref|XP_012852946.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Erythranthe guttatus] gi|604305166|gb|EYU24345.1| hypothetical protein MIMGU_mgv11b005010mg [Erythranthe guttata] Length = 457 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -3 Query: 147 EDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLDL 7 +D IS+LP DIL I+S L++ EGARTS+LS+RW NLW S +CL+L Sbjct: 29 DDRISRLPDDILVHILSFLSVEEGARTSVLSSRWINLWKYS-TCLNL 74 >emb|CDP07614.1| unnamed protein product [Coffea canephora] Length = 480 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/47 (55%), Positives = 38/47 (80%) Frame = -3 Query: 150 IEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLD 10 ++D IS+LP +IL +I+S LT++E ARTS+LS RW +LW S++CLD Sbjct: 23 LKDQISRLPDEILVYILSCLTLKEAARTSVLSKRWIDLW-RSMACLD 68 >emb|CDP07607.1| unnamed protein product [Coffea canephora] Length = 449 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/47 (55%), Positives = 38/47 (80%) Frame = -3 Query: 150 IEDHISKLPKDILHFIISILTMREGARTSILSTRWRNLWSESLSCLD 10 ++D IS+LP +IL +I+S LT++E ARTS+LS RW +LW S++CLD Sbjct: 23 LKDQISRLPDEILVYILSCLTLKEAARTSVLSKRWIDLW-RSMACLD 68