BLASTX nr result
ID: Aconitum23_contig00012598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00012598 (305 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325438.1| cationic amino acid transporter 3 family pro... 66 9e-09 ref|XP_011001714.1| PREDICTED: cationic amino acid transporter 2... 65 2e-08 ref|XP_010266710.1| PREDICTED: cationic amino acid transporter 2... 57 5e-06 >ref|XP_002325438.1| cationic amino acid transporter 3 family protein [Populus trichocarpa] gi|222862313|gb|EEE99819.1| cationic amino acid transporter 3 family protein [Populus trichocarpa] Length = 641 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = +1 Query: 151 MGLAADQPRGSASNGGNGGFRSLIRRKQVDSVHNRAEGHQKLAKELSILQL 303 MG D +G GG G FRSLIRRKQVDSVH++ GH +LAKELSIL L Sbjct: 1 MGFLVDSHKGGCGVGGGGCFRSLIRRKQVDSVHSKGHGHHRLAKELSILHL 51 >ref|XP_011001714.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Populus euphratica] Length = 641 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = +1 Query: 151 MGLAADQPRGSASNGGNGGFRSLIRRKQVDSVHNRAEGHQKLAKELSILQL 303 MG D +G GG G FRSL RRKQVDSVH++A GH +LAKELS+L L Sbjct: 1 MGFLVDSHKGGCGVGGGGCFRSLTRRKQVDSVHSKAHGHHQLAKELSVLHL 51 >ref|XP_010266710.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Nelumbo nucifera] Length = 344 Score = 57.0 bits (136), Expect = 5e-06 Identities = 42/97 (43%), Positives = 51/97 (52%), Gaps = 6/97 (6%) Frame = +1 Query: 31 PLKLTSFDPSRQSGRWVLLQ-FSNNPGLNHPPRLG--GFLRNSMGLAADQPRGSASNGGN 201 P ++ F S Q G W+ + + N P R G G MG D G S G Sbjct: 14 PSPVSGFGISGQVGGWLGVGLYPNQPCFGDCVRSGRGGEAGELMGRVVDSEMGCRSGDGG 73 Query: 202 G---GFRSLIRRKQVDSVHNRAEGHQKLAKELSILQL 303 G G R ++RRKQVDSVH R EG Q+LAKEL+ILQL Sbjct: 74 GSSWGIRCVLRRKQVDSVHVRTEG-QQLAKELTILQL 109