BLASTX nr result
ID: Aconitum23_contig00010543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00010543 (404 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQL14028.1| hypothetical protein SETIT_022299mg [Setaria ital... 90 7e-16 gb|ACM90154.1| hypersensitive induced response protein 3 [Tritic... 90 7e-16 gb|ACI25443.1| hypersensitive induced response protein 3 [Tritic... 90 7e-16 gb|EMT16611.1| hypothetical protein F775_27006 [Aegilops tauschii] 90 7e-16 gb|EMS61337.1| Hypersensitive-induced response protein 1 [Tritic... 90 7e-16 gb|EMS53976.1| Hypersensitive-induced response protein 1 [Tritic... 90 7e-16 ref|XP_008648274.1| PREDICTED: hypersensitive induced reaction3 ... 89 1e-15 ref|NP_001056492.1| Os05g0591900 [Oryza sativa Japonica Group] g... 89 2e-15 gb|AAN17464.1| hypersensitive-induced reaction protein 3 [Hordeu... 89 2e-15 ref|XP_004961021.1| PREDICTED: hypersensitive-induced response p... 88 2e-15 gb|ACG34534.1| hypersensitive-induced response protein [Zea mays] 87 4e-15 ref|XP_006654866.1| PREDICTED: hypersensitive-induced response p... 87 4e-15 ref|NP_001104972.1| hypersensitive induced reaction3 [Zea mays] ... 87 4e-15 gb|AFD54043.1| hypersensitive induced reaction protein 3 [Tritic... 87 5e-15 gb|ABS01349.1| hypersensitive-induced response protein [Carica p... 87 5e-15 ref|XP_011071605.1| PREDICTED: hypersensitive-induced response p... 87 6e-15 ref|XP_010238201.1| PREDICTED: hypersensitive-induced response p... 87 6e-15 ref|XP_012080206.1| PREDICTED: hypersensitive-induced response p... 87 6e-15 tpg|DAA44972.1| TPA: hypothetical protein ZEAMMB73_888315 [Zea m... 87 6e-15 ref|XP_010932564.1| PREDICTED: hypersensitive-induced response p... 86 8e-15 >gb|KQL14028.1| hypothetical protein SETIT_022299mg [Setaria italica] Length = 389 Score = 89.7 bits (221), Expect = 7e-16 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +3 Query: 273 AMGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 AMGNL CCVQVDQSTVAIREQFGKFD VLEPGCHC+PW+ GK++ Sbjct: 102 AMGNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCMPWFIGKRV 145 >gb|ACM90154.1| hypersensitive induced response protein 3 [Triticum aestivum] Length = 287 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFGKFD VLEPGCHCLPW FGK++ Sbjct: 1 MGNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCLPWIFGKRV 43 >gb|ACI25443.1| hypersensitive induced response protein 3 [Triticum aestivum] gi|475575627|gb|EMT17323.1| hypothetical protein F775_29833 [Aegilops tauschii] Length = 287 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFGKFD VLEPGCHCLPW FGK++ Sbjct: 1 MGNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCLPWIFGKRV 43 >gb|EMT16611.1| hypothetical protein F775_27006 [Aegilops tauschii] Length = 255 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFGKFD VLEPGCHCLPW FGK++ Sbjct: 1 MGNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCLPWIFGKRV 43 >gb|EMS61337.1| Hypersensitive-induced response protein 1 [Triticum urartu] Length = 295 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFGKFD VLEPGCHCLPW FGK++ Sbjct: 1 MGNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCLPWIFGKRV 43 >gb|EMS53976.1| Hypersensitive-induced response protein 1 [Triticum urartu] Length = 254 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFGKFD VLEPGCHCLPW FGK++ Sbjct: 1 MGNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCLPWIFGKRV 43 >ref|XP_008648274.1| PREDICTED: hypersensitive induced reaction3 isoform X2 [Zea mays] gi|413946722|gb|AFW79371.1| hypersensitive-induced response protein [Zea mays] Length = 333 Score = 89.0 bits (219), Expect = 1e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +3 Query: 273 AMGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 AMGNL CCVQVDQSTVAIREQFGKFD VLEPGCHC+PW+ GK++ Sbjct: 46 AMGNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCMPWFAGKRV 89 >ref|NP_001056492.1| Os05g0591900 [Oryza sativa Japonica Group] gi|48475228|gb|AAT44297.1| putative hypersensitive-induced response protein [Oryza sativa Japonica Group] gi|113580043|dbj|BAF18406.1| Os05g0591900 [Oryza sativa Japonica Group] gi|125553541|gb|EAY99250.1| hypothetical protein OsI_21211 [Oryza sativa Indica Group] gi|215701471|dbj|BAG92895.1| unnamed protein product [Oryza sativa Japonica Group] gi|215737490|dbj|BAG96620.1| unnamed protein product [Oryza sativa Japonica Group] gi|215737615|dbj|BAG96745.1| unnamed protein product [Oryza sativa Japonica Group] gi|215767071|dbj|BAG99299.1| unnamed protein product [Oryza sativa Japonica Group] gi|215767262|dbj|BAG99490.1| unnamed protein product [Oryza sativa Japonica Group] gi|222632761|gb|EEE64893.1| hypothetical protein OsJ_19752 [Oryza sativa Japonica Group] gi|937920711|dbj|BAS95629.1| Os05g0591900 [Oryza sativa Japonica Group] Length = 288 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFGKFD VLEPGCHCLPW+ GK+I Sbjct: 1 MGNLFCCVQVDQSTVAIREQFGKFDAVLEPGCHCLPWFAGKRI 43 >gb|AAN17464.1| hypersensitive-induced reaction protein 3 [Hordeum vulgare subsp. vulgare] gi|23345050|gb|AAN17456.1| hypersensitive-induced reaction protein 3 [Hordeum vulgare subsp. vulgare] gi|326493170|dbj|BAJ85046.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 287 Score = 88.6 bits (218), Expect = 2e-15 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFGKFD VL+PGCHCLPW FGK++ Sbjct: 1 MGNLCCCVQVDQSTVAIREQFGKFDSVLQPGCHCLPWIFGKRV 43 >ref|XP_004961021.1| PREDICTED: hypersensitive-induced response protein 1 [Setaria italica] gi|514746037|ref|XP_004961022.1| PREDICTED: hypersensitive-induced response protein 1 [Setaria italica] gi|514746039|ref|XP_004961023.1| PREDICTED: hypersensitive-induced response protein 1 [Setaria italica] gi|835950552|ref|XP_012700243.1| PREDICTED: hypersensitive-induced response protein 1 [Setaria italica] gi|944249766|gb|KQL14029.1| hypothetical protein SETIT_022299mg [Setaria italica] gi|944249767|gb|KQL14030.1| hypothetical protein SETIT_022299mg [Setaria italica] gi|944249768|gb|KQL14031.1| hypothetical protein SETIT_022299mg [Setaria italica] Length = 287 Score = 88.2 bits (217), Expect = 2e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFGKFD VLEPGCHC+PW+ GK++ Sbjct: 1 MGNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCMPWFIGKRV 43 >gb|ACG34534.1| hypersensitive-induced response protein [Zea mays] Length = 287 Score = 87.4 bits (215), Expect = 4e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFGKFD VLEPGCHC+PW+ GK++ Sbjct: 1 MGNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCMPWFAGKRV 43 >ref|XP_006654866.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X1 [Oryza brachyantha] gi|573945053|ref|XP_006654867.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X2 [Oryza brachyantha] gi|573945055|ref|XP_006654868.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X3 [Oryza brachyantha] Length = 287 Score = 87.4 bits (215), Expect = 4e-15 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIRE FGKFD VLEPGCHCLPW+ GK+I Sbjct: 1 MGNLFCCVQVDQSTVAIRETFGKFDSVLEPGCHCLPWFIGKRI 43 >ref|NP_001104972.1| hypersensitive induced reaction3 [Zea mays] gi|670414105|ref|XP_008648275.1| PREDICTED: hypersensitive induced reaction3 isoform X1 [Zea mays] gi|670414107|ref|XP_008648276.1| PREDICTED: hypersensitive induced reaction3 isoform X1 [Zea mays] gi|670414109|ref|XP_008648277.1| PREDICTED: hypersensitive induced reaction3 isoform X1 [Zea mays] gi|670414111|ref|XP_008648278.1| PREDICTED: hypersensitive induced reaction3 isoform X1 [Zea mays] gi|7716470|gb|AAF68391.1|AF236375_1 hypersensitive-induced response protein [Zea mays] gi|194693510|gb|ACF80839.1| unknown [Zea mays] gi|194706174|gb|ACF87171.1| unknown [Zea mays] gi|195621530|gb|ACG32595.1| hypersensitive-induced response protein [Zea mays] gi|223973725|gb|ACN31050.1| unknown [Zea mays] gi|238014282|gb|ACR38176.1| unknown [Zea mays] gi|413946723|gb|AFW79372.1| hypersensitive-induced response protein isoform 1 [Zea mays] gi|413946724|gb|AFW79373.1| hypersensitive-induced response protein isoform 2 [Zea mays] gi|413946725|gb|AFW79374.1| hypersensitive-induced response protein isoform 3 [Zea mays] gi|413946726|gb|AFW79375.1| hypersensitive-induced response protein isoform 4 [Zea mays] gi|413946727|gb|AFW79376.1| hypersensitive-induced response protein isoform 5 [Zea mays] Length = 287 Score = 87.4 bits (215), Expect = 4e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFGKFD VLEPGCHC+PW+ GK++ Sbjct: 1 MGNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCMPWFAGKRV 43 >gb|AFD54043.1| hypersensitive induced reaction protein 3 [Triticum aestivum] Length = 287 Score = 87.0 bits (214), Expect = 5e-15 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIR QFGKFD VLEPGCHCLPW FGK++ Sbjct: 1 MGNLCCCVQVDQSTVAIRGQFGKFDSVLEPGCHCLPWIFGKRV 43 >gb|ABS01349.1| hypersensitive-induced response protein [Carica papaya] Length = 285 Score = 87.0 bits (214), Expect = 5e-15 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIRE+FGKFD VLEPGCHCLPW+ G Q+ Sbjct: 1 MGNLFCCVQVDQSTVAIRERFGKFDDVLEPGCHCLPWFLGSQL 43 >ref|XP_011071605.1| PREDICTED: hypersensitive-induced response protein 1 [Sesamum indicum] Length = 287 Score = 86.7 bits (213), Expect = 6e-15 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAI+E+FGKFD+VLEPGCHCLPW+ G Q+ Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGCHCLPWFLGSQL 43 >ref|XP_010238201.1| PREDICTED: hypersensitive-induced response protein 1 [Brachypodium distachyon] gi|721680306|ref|XP_010238202.1| PREDICTED: hypersensitive-induced response protein 1 [Brachypodium distachyon] gi|944054738|gb|KQJ90376.1| hypothetical protein BRADI_4g31150 [Brachypodium distachyon] gi|944054739|gb|KQJ90377.1| hypothetical protein BRADI_4g31150 [Brachypodium distachyon] Length = 287 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNL CCVQVDQSTVAIREQFG+FD VLEPGCHCLPW GK+I Sbjct: 1 MGNLCCCVQVDQSTVAIREQFGRFDSVLEPGCHCLPWMIGKRI 43 >ref|XP_012080206.1| PREDICTED: hypersensitive-induced response protein 1 [Jatropha curcas] gi|802652830|ref|XP_012080207.1| PREDICTED: hypersensitive-induced response protein 1 [Jatropha curcas] gi|802652834|ref|XP_012080208.1| PREDICTED: hypersensitive-induced response protein 1 [Jatropha curcas] gi|643720943|gb|KDP31207.1| hypothetical protein JCGZ_11583 [Jatropha curcas] Length = 285 Score = 86.7 bits (213), Expect = 6e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MGNLLCCVQVDQSTVAIRE+FGKFD+VL+PGCHCLPW G Q+ Sbjct: 1 MGNLLCCVQVDQSTVAIRERFGKFDEVLDPGCHCLPWILGSQL 43 >tpg|DAA44972.1| TPA: hypothetical protein ZEAMMB73_888315 [Zea mays] Length = 145 Score = 86.7 bits (213), Expect = 6e-15 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +3 Query: 273 AMGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 AM NL CCVQVDQSTVAIREQFGKFD VLEPGCHC+PW+ GK++ Sbjct: 18 AMSNLCCCVQVDQSTVAIREQFGKFDSVLEPGCHCMPWFAGKRV 61 >ref|XP_010932564.1| PREDICTED: hypersensitive-induced response protein 1 [Elaeis guineensis] gi|743755086|ref|XP_010932640.1| PREDICTED: hypersensitive-induced response protein 1 [Elaeis guineensis] gi|743755088|ref|XP_010932707.1| PREDICTED: hypersensitive-induced response protein 1 [Elaeis guineensis] Length = 285 Score = 86.3 bits (212), Expect = 8e-15 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 276 MGNLLCCVQVDQSTVAIREQFGKFDQVLEPGCHCLPWYFGKQI 404 MG LLCCVQVDQSTVAIRE FGKFD VLEPGCHCLPW FG++I Sbjct: 1 MGQLLCCVQVDQSTVAIRETFGKFDDVLEPGCHCLPWIFGRRI 43