BLASTX nr result
ID: Aconitum23_contig00009977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00009977 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010095279.1| hypothetical protein L484_014620 [Morus nota... 123 6e-26 ref|XP_010277336.1| PREDICTED: pentatricopeptide repeat-containi... 123 6e-26 gb|KDO79503.1| hypothetical protein CISIN_1g015673mg [Citrus sin... 120 3e-25 ref|XP_006425713.1| hypothetical protein CICLE_v10025762mg [Citr... 120 3e-25 ref|XP_010548343.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_010531018.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 emb|CAN68320.1| hypothetical protein VITISV_032192 [Vitis vinifera] 117 4e-24 ref|XP_002271426.1| PREDICTED: pentatricopeptide repeat-containi... 116 6e-24 gb|AEI98618.1| hypothetical protein 111O18.5 [Coffea canephora] 116 6e-24 ref|XP_013731395.1| PREDICTED: pentatricopeptide repeat-containi... 116 8e-24 ref|XP_008338124.1| PREDICTED: pentatricopeptide repeat-containi... 116 8e-24 ref|XP_006297760.1| hypothetical protein CARUB_v10013794mg [Caps... 115 1e-23 ref|XP_010680824.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_009371566.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_009112497.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 emb|CDY67618.1| BnaA09g52830D [Brassica napus] 115 1e-23 emb|CDP02821.1| unnamed protein product [Coffea canephora] 115 1e-23 ref|XP_008338664.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_006363148.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_004232380.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 >ref|XP_010095279.1| hypothetical protein L484_014620 [Morus notabilis] gi|587869823|gb|EXB59125.1| hypothetical protein L484_014620 [Morus notabilis] Length = 400 Score = 123 bits (308), Expect = 6e-26 Identities = 60/98 (61%), Positives = 78/98 (79%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KSRRFDDIE+ +ESHKK P+I E F+SSLIRSYG+A M AL+ FE+M+ELG RS + Sbjct: 67 KSRRFDDIESFLESHKKDPKIKQEPFLSSLIRSYGQAGMFGHALKTFEQMEELGTPRSAI 126 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFN+LL ++K +D+V +LFDEIP+KYG++PD ISY Sbjct: 127 SFNSLLSACNQSKLFDKVLQLFDEIPKKYGVSPDGISY 164 >ref|XP_010277336.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nelumbo nucifera] Length = 396 Score = 123 bits (308), Expect = 6e-26 Identities = 63/98 (64%), Positives = 74/98 (75%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KSRRF DIE LIESHKK P+IT E F+S+LIRSYG A M D AL+ F +M LG RS + Sbjct: 67 KSRRFSDIEKLIESHKKDPKITQEPFLSTLIRSYGRAGMFDHALQTFNQMNALGTPRSAI 126 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFNALL ++KK+D+V KLF EI QKYGI+PD ISY Sbjct: 127 SFNALLSACNQSKKFDQVPKLFSEISQKYGISPDKISY 164 >gb|KDO79503.1| hypothetical protein CISIN_1g015673mg [Citrus sinensis] Length = 403 Score = 120 bits (302), Expect = 3e-25 Identities = 58/98 (59%), Positives = 75/98 (76%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KS+RF DIE LIESHK P+IT E ++ +LIRSYG+A M D A+R F++M ELG RS + Sbjct: 74 KSKRFSDIETLIESHKNDPKITQEPYLCNLIRSYGQAGMFDHAMRTFDQMDELGTPRSVI 133 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFNALLF +++ YD+V LFDEIP+KY ++PD ISY Sbjct: 134 SFNALLFACTRSRLYDKVPILFDEIPKKYNLSPDKISY 171 >ref|XP_006425713.1| hypothetical protein CICLE_v10025762mg [Citrus clementina] gi|568824774|ref|XP_006466769.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Citrus sinensis] gi|557527703|gb|ESR38953.1| hypothetical protein CICLE_v10025762mg [Citrus clementina] Length = 403 Score = 120 bits (302), Expect = 3e-25 Identities = 58/98 (59%), Positives = 75/98 (76%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KS+RF DIE LIESHK P+IT E ++ +LIRSYG+A M D A+R F++M ELG RS + Sbjct: 74 KSKRFSDIETLIESHKNDPKITQEPYLCNLIRSYGQAGMFDHAMRTFDQMDELGTPRSVI 133 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFNALLF +++ YD+V LFDEIP+KY ++PD ISY Sbjct: 134 SFNALLFACTRSRLYDKVPILFDEIPKKYNLSPDKISY 171 >ref|XP_010548343.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Tarenaya hassleriana] Length = 415 Score = 118 bits (296), Expect = 2e-24 Identities = 58/98 (59%), Positives = 74/98 (75%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KSRRF DIEAL+ESHK P+I +E F+S+LIRSYG A M D ALR +E+M++ G RS + Sbjct: 84 KSRRFTDIEALVESHKNDPKIKEEPFLSTLIRSYGRAAMFDHALRTYEQMEQFGTPRSAV 143 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFNALL + + +D V +LF+EIPQ+Y ITPD ISY Sbjct: 144 SFNALLTACLHSGLFDRVPQLFEEIPQRYNITPDKISY 181 >ref|XP_010531018.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Tarenaya hassleriana] Length = 414 Score = 118 bits (295), Expect = 2e-24 Identities = 57/98 (58%), Positives = 75/98 (76%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KSRRF DIEALIESHK P+I +E F+S+LIRSYG A M D A+R +E+M++ G RS + Sbjct: 84 KSRRFSDIEALIESHKNDPKIKEEPFLSTLIRSYGRAAMFDHAMRTYEQMEQFGTPRSAV 143 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFNALL + ++ ++ V +LF+EIPQ+Y ITPD ISY Sbjct: 144 SFNALLSACLHSELFERVPQLFEEIPQRYNITPDKISY 181 >emb|CAN68320.1| hypothetical protein VITISV_032192 [Vitis vinifera] Length = 416 Score = 117 bits (292), Expect = 4e-24 Identities = 59/98 (60%), Positives = 74/98 (75%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KSRRF DIE LIESHK P+IT E ++S+LIRSYG A M ALR F +M+ELG RS++ Sbjct: 85 KSRRFADIETLIESHKNDPKITQEPYLSTLIRSYGIAGMFQHALRTFNQMEELGTPRSSI 144 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFNALL ++K +D+V K F+EIP++YGI PD ISY Sbjct: 145 SFNALLSACNQSKLFDQVPKFFEEIPRRYGIXPDKISY 182 >ref|XP_002271426.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Vitis vinifera] Length = 414 Score = 116 bits (291), Expect = 6e-24 Identities = 58/98 (59%), Positives = 74/98 (75%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KSRRF DIE LIESHK P+IT E ++S+LIRSYG A M ALR F +M+ELG RS++ Sbjct: 83 KSRRFADIETLIESHKNDPKITQEPYLSTLIRSYGIAGMFQHALRTFNQMEELGTPRSSI 142 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFNALL ++K +D+V K F+EIP++YG+ PD ISY Sbjct: 143 SFNALLSACNQSKLFDQVPKFFEEIPRRYGVLPDKISY 180 >gb|AEI98618.1| hypothetical protein 111O18.5 [Coffea canephora] Length = 417 Score = 116 bits (291), Expect = 6e-24 Identities = 57/100 (57%), Positives = 71/100 (71%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KS RF DIE+ +ESHK P+IT E F+SSLIRSYG A M D AL+ F EM +LG RST+ Sbjct: 89 KSHRFSDIESFLESHKNDPKITQEPFLSSLIRSYGLAGMFDHALKTFNEMDDLGTPRSTV 148 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISYSN 302 SFNALL +K + +LFDE+PQ+YG++PD SY N Sbjct: 149 SFNALLSACNSSKNFGRAPELFDEVPQRYGLSPDKFSYGN 188 >ref|XP_013731395.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18520, mitochondrial-like [Brassica napus] Length = 419 Score = 116 bits (290), Expect = 8e-24 Identities = 59/99 (59%), Positives = 74/99 (74%), Gaps = 1/99 (1%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 +S RF D+EALIES KK PQI ESF+S+LIRSYG A M D A+R FEEMK+LG RS + Sbjct: 78 RSHRFSDVEALIESRKKDPQIKTESFLSTLIRSYGRASMFDHAMRTFEEMKQLGTPRSVV 137 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKY-GITPDSISY 296 SFNALL + + ++ V +LFDE+PQ+Y ITPD +SY Sbjct: 138 SFNALLAACLHSDLFERVPQLFDEMPQRYRNITPDKVSY 176 >ref|XP_008338124.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Malus domestica] Length = 405 Score = 116 bits (290), Expect = 8e-24 Identities = 56/98 (57%), Positives = 73/98 (74%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KS RF DIE+ IESHK P+IT E F+S+LIRSYG A M DQALR F++M++LG R+ + Sbjct: 70 KSHRFADIESFIESHKNDPKITQEPFLSTLIRSYGRAGMFDQALRTFDQMEQLGTPRTAI 129 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFN LL +K +D V +LFDEIP K+G++PD +SY Sbjct: 130 SFNTLLSACNDSKHFDSVPQLFDEIPSKHGVSPDKVSY 167 >ref|XP_006297760.1| hypothetical protein CARUB_v10013794mg [Capsella rubella] gi|482566469|gb|EOA30658.1| hypothetical protein CARUB_v10013794mg [Capsella rubella] Length = 420 Score = 115 bits (289), Expect = 1e-23 Identities = 59/99 (59%), Positives = 75/99 (75%), Gaps = 1/99 (1%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KS+RF DIEALIESHK P+I E+F+S+LIRSYG A M D A+++FEEM +LG RS + Sbjct: 75 KSQRFSDIEALIESHKNNPKIKTETFLSTLIRSYGRASMFDHAMKMFEEMDQLGTPRSVV 134 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKY-GITPDSISY 296 SFNALL + + ++ V +LFDEIPQ+Y ITPD ISY Sbjct: 135 SFNALLAACLHSDLFERVPQLFDEIPQRYDNITPDKISY 173 >ref|XP_010680824.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870857503|gb|KMT09063.1| hypothetical protein BVRB_6g137640 [Beta vulgaris subsp. vulgaris] Length = 401 Score = 115 bits (288), Expect = 1e-23 Identities = 56/98 (57%), Positives = 73/98 (74%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 K+ RF+DIE+LIESHKK P+IT E F+ SLIR YG+A M D AL + +M+ELG RSTL Sbjct: 69 KAHRFNDIESLIESHKKSPKITQEPFLCSLIRCYGKAGMFDHALNTYNQMEELGTPRSTL 128 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFNALL ++ +D V +LFDE+P++YG PD +SY Sbjct: 129 SFNALLTACNHSRLFDNVPQLFDEMPKRYGFVPDKVSY 166 >ref|XP_009371566.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Pyrus x bretschneideri] Length = 405 Score = 115 bits (288), Expect = 1e-23 Identities = 56/98 (57%), Positives = 72/98 (73%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KS RF DIE+ IESHK P+IT E F+S+LIRSYG A M DQALR F++M +LG R+ + Sbjct: 70 KSHRFADIESFIESHKNDPKITQEPFLSTLIRSYGRAGMFDQALRTFDQMDQLGTPRTAI 129 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFN LL +K +D V +LFDEIP K+G++PD +SY Sbjct: 130 SFNTLLSACNDSKHFDRVPQLFDEIPSKHGVSPDKVSY 167 >ref|XP_009112497.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18520, mitochondrial [Brassica rapa] Length = 419 Score = 115 bits (288), Expect = 1e-23 Identities = 59/99 (59%), Positives = 74/99 (74%), Gaps = 1/99 (1%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 +S RF D+EALIES KK PQI ESF+S+LIRSYG A M D ALR FEEM++LG RS + Sbjct: 78 RSHRFSDVEALIESRKKDPQIKTESFLSTLIRSYGRASMFDHALRTFEEMEQLGTPRSVV 137 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKY-GITPDSISY 296 SFNALL + + ++ V +LFDE+PQ+Y ITPD +SY Sbjct: 138 SFNALLAACLHSDLFERVPQLFDEMPQRYRNITPDKVSY 176 >emb|CDY67618.1| BnaA09g52830D [Brassica napus] Length = 419 Score = 115 bits (288), Expect = 1e-23 Identities = 59/99 (59%), Positives = 74/99 (74%), Gaps = 1/99 (1%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 +S RF D+EALIES KK PQI ESF+S+LIRSYG A M D ALR FEEM++LG RS + Sbjct: 78 RSHRFSDVEALIESRKKDPQIKTESFLSTLIRSYGRASMFDHALRTFEEMEQLGTPRSVV 137 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKY-GITPDSISY 296 SFNALL + + ++ V +LFDE+PQ+Y ITPD +SY Sbjct: 138 SFNALLAACLHSDLFERVPQLFDEMPQRYRNITPDKVSY 176 >emb|CDP02821.1| unnamed protein product [Coffea canephora] Length = 417 Score = 115 bits (288), Expect = 1e-23 Identities = 57/100 (57%), Positives = 70/100 (70%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KS RF DIE +ESHK P+IT E F+SSLIRSYG A M D AL+ F EM +LG RST+ Sbjct: 89 KSHRFSDIENFLESHKNDPKITQEPFLSSLIRSYGLAGMFDHALKTFNEMDDLGTPRSTV 148 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISYSN 302 SFNALL +K + +LFDE+PQ+YG++PD SY N Sbjct: 149 SFNALLSACNSSKNFGRAPELFDEVPQRYGLSPDKFSYGN 188 >ref|XP_008338664.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Malus domestica] Length = 405 Score = 115 bits (288), Expect = 1e-23 Identities = 56/98 (57%), Positives = 72/98 (73%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KS RF DIE+ IESHK P+IT E F+S+LIRSYG A M DQALR F++M +LG R+ + Sbjct: 70 KSHRFADIESFIESHKNDPKITQEPFLSTLIRSYGRAGMFDQALRTFDQMDQLGTPRTAI 129 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFN LL +K +D V +LFDEIP K+G++PD +SY Sbjct: 130 SFNTLLSACNDSKHFDRVPQLFDEIPNKHGVSPDKVSY 167 >ref|XP_006363148.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Solanum tuberosum] Length = 406 Score = 115 bits (288), Expect = 1e-23 Identities = 55/98 (56%), Positives = 70/98 (71%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KS RF DIE +ESHK P+IT E F+SS+IRSYG A M D AL+++ +M +LG RS + Sbjct: 80 KSHRFSDIENFLESHKNSPKITQEPFLSSIIRSYGVAGMFDHALKIYHQMDDLGTPRSAI 139 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFN LL +++K YD V +LFDEIP KYG PD +SY Sbjct: 140 SFNVLLSACVRSKLYDRVPQLFDEIPVKYGFLPDKVSY 177 >ref|XP_004232380.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Solanum lycopersicum] Length = 405 Score = 115 bits (288), Expect = 1e-23 Identities = 55/98 (56%), Positives = 70/98 (71%) Frame = +3 Query: 3 KSRRFDDIEALIESHKKFPQITDESFVSSLIRSYGEAKMPDQALRLFEEMKELGASRSTL 182 KS RF DIE +ESHK P+IT E F+SS+IRSYG A M D AL+++ +M +LG RS + Sbjct: 79 KSHRFSDIENFLESHKNSPKITQEPFLSSIIRSYGVAGMFDHALKIYHQMDDLGTPRSAI 138 Query: 183 SFNALLFCHIKAKKYDEVKKLFDEIPQKYGITPDSISY 296 SFN LL +++K YD V +LFDEIP KYG PD +SY Sbjct: 139 SFNVLLSACVRSKLYDRVPQLFDEIPVKYGFLPDKVSY 176