BLASTX nr result
ID: Aconitum23_contig00009946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00009946 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMZ64925.1| Thaumatin-like protein 1 [Zostera marina] 64 4e-08 ref|XP_007136098.1| hypothetical protein PHAVU_009G017700g [Phas... 64 4e-08 ref|XP_006369399.1| hypothetical protein POPTR_0001s22870g [Popu... 63 1e-07 gb|EMT10173.1| hypothetical protein F775_27239 [Aegilops tauschii] 63 1e-07 gb|EMT04601.1| hypothetical protein F775_15619 [Aegilops tauschii] 63 1e-07 gb|KFK33653.1| hypothetical protein AALP_AA5G041900 [Arabis alpina] 62 1e-07 ref|XP_004499280.1| PREDICTED: thaumatin-like protein 1b [Cicer ... 62 1e-07 ref|XP_009344128.1| PREDICTED: thaumatin-like protein 1a [Pyrus ... 62 2e-07 ref|XP_009358005.1| PREDICTED: thaumatin-like protein 1b [Pyrus ... 62 2e-07 ref|XP_006473671.1| PREDICTED: thaumatin-like protein 1-like [Ci... 62 2e-07 ref|XP_006435193.1| hypothetical protein CICLE_v10001885mg [Citr... 62 2e-07 gb|EPS73012.1| hypothetical protein M569_01746, partial [Genlise... 62 2e-07 dbj|BAS83221.1| Os03g0244200, partial [Oryza sativa Japonica Group] 61 3e-07 gb|KNA17117.1| hypothetical protein SOVF_083130 [Spinacia oleracea] 61 3e-07 ref|XP_012571513.1| PREDICTED: thaumatin-like protein 1b isoform... 61 3e-07 ref|XP_011006040.1| PREDICTED: thaumatin-like protein 1, partial... 61 3e-07 ref|XP_011005397.1| PREDICTED: thaumatin-like protein 1b isoform... 61 3e-07 ref|XP_011005396.1| PREDICTED: thaumatin-like protein 1 isoform ... 61 3e-07 ref|XP_010531541.1| PREDICTED: thaumatin-like protein 1b [Tarena... 61 3e-07 gb|AHY84684.1| thaumatin-like protein [Populus szechuanica] 61 3e-07 >gb|KMZ64925.1| Thaumatin-like protein 1 [Zostera marina] Length = 261 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK ACP+AY+YAYDD TS FTCP+G+D+ ITFCP Sbjct: 216 FKKACPAAYSYAYDDATSTFTCPTGTDYDITFCP 249 >ref|XP_007136098.1| hypothetical protein PHAVU_009G017700g [Phaseolus vulgaris] gi|561009185|gb|ESW08092.1| hypothetical protein PHAVU_009G017700g [Phaseolus vulgaris] Length = 330 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FKNACP AY+YAYDDKTS FTC S +D+ ITFCP Sbjct: 217 FKNACPRAYSYAYDDKTSTFTCASSADYTITFCP 250 >ref|XP_006369399.1| hypothetical protein POPTR_0001s22870g [Populus trichocarpa] gi|550347931|gb|ERP65968.1| hypothetical protein POPTR_0001s22870g [Populus trichocarpa] Length = 250 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK CP AY+YAYDDKTS FTCPSG ++ ITFCP Sbjct: 217 FKKQCPQAYSYAYDDKTSTFTCPSGGNYLITFCP 250 >gb|EMT10173.1| hypothetical protein F775_27239 [Aegilops tauschii] Length = 169 Score = 62.8 bits (151), Expect = 1e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK CP AY+YAYDDK+S FTCP GSD+++TFCP Sbjct: 136 FKGLCPDAYSYAYDDKSSSFTCPVGSDYQVTFCP 169 >gb|EMT04601.1| hypothetical protein F775_15619 [Aegilops tauschii] Length = 157 Score = 62.8 bits (151), Expect = 1e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK CP AY+YAYDDK+S FTCP GSD+++TFCP Sbjct: 124 FKGHCPDAYSYAYDDKSSTFTCPVGSDYQVTFCP 157 >gb|KFK33653.1| hypothetical protein AALP_AA5G041900 [Arabis alpina] Length = 249 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FKNACPSAY+YAYDD TSIFTC SGS++ ITFCP Sbjct: 214 FKNACPSAYSYAYDDATSIFTC-SGSNYLITFCP 246 >ref|XP_004499280.1| PREDICTED: thaumatin-like protein 1b [Cicer arietinum] Length = 325 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FKNACP AY+YAYDDKTS FTC + D+ ITFCP Sbjct: 217 FKNACPRAYSYAYDDKTSTFTCANAGDYSITFCP 250 >ref|XP_009344128.1| PREDICTED: thaumatin-like protein 1a [Pyrus x bretschneideri] Length = 248 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK+ CP AY+YAYDDK+SIFTC GSD+ ITFCP Sbjct: 215 FKDQCPQAYSYAYDDKSSIFTCNGGSDYIITFCP 248 >ref|XP_009358005.1| PREDICTED: thaumatin-like protein 1b [Pyrus x bretschneideri] Length = 242 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK+ CP AY+YAYDDKTSIFTC G D+ ITFCP Sbjct: 209 FKSQCPQAYSYAYDDKTSIFTCTGGPDYVITFCP 242 >ref|XP_006473671.1| PREDICTED: thaumatin-like protein 1-like [Citrus sinensis] Length = 317 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK+ACP AY+YAYDDK+S FTC SG D+ ITFCP Sbjct: 212 FKSACPHAYSYAYDDKSSTFTCGSGPDYTITFCP 245 >ref|XP_006435193.1| hypothetical protein CICLE_v10001885mg [Citrus clementina] gi|557537315|gb|ESR48433.1| hypothetical protein CICLE_v10001885mg [Citrus clementina] Length = 317 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK+ACP AY+YAYDDK+S FTC SG D+ ITFCP Sbjct: 212 FKSACPHAYSYAYDDKSSTFTCGSGPDYTITFCP 245 >gb|EPS73012.1| hypothetical protein M569_01746, partial [Genlisea aurea] Length = 220 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK CP AY+YA+DDKTS FTCP+G D+ ITFCP Sbjct: 187 FKGFCPQAYSYAFDDKTSTFTCPTGGDYLITFCP 220 >dbj|BAS83221.1| Os03g0244200, partial [Oryza sativa Japonica Group] Length = 283 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FKNACP AY+YAYDD TS FTC +G+++ ITFCP Sbjct: 246 FKNACPRAYSYAYDDSTSTFTCTAGTNYAITFCP 279 >gb|KNA17117.1| hypothetical protein SOVF_083130 [Spinacia oleracea] Length = 198 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FKN CP AY+YAYDD TS FTCP+G ++ ITFCP Sbjct: 165 FKNQCPQAYSYAYDDSTSTFTCPTGVNYLITFCP 198 >ref|XP_012571513.1| PREDICTED: thaumatin-like protein 1b isoform X2 [Cicer arietinum] Length = 266 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFC 219 FKNACP AY+YAYDDKTS FTC S +D+ ITFC Sbjct: 216 FKNACPRAYSYAYDDKTSTFTCESAADYTITFC 248 >ref|XP_011006040.1| PREDICTED: thaumatin-like protein 1, partial [Populus euphratica] Length = 243 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK CP AY+YAYDD+TS FTCPSG ++ ITFCP Sbjct: 210 FKQQCPEAYSYAYDDETSTFTCPSGGNYLITFCP 243 >ref|XP_011005397.1| PREDICTED: thaumatin-like protein 1b isoform X2 [Populus euphratica] Length = 245 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK CP AY+YAYDD+TS FTCPSG ++ ITFCP Sbjct: 212 FKQQCPEAYSYAYDDETSTFTCPSGGNYLITFCP 245 >ref|XP_011005396.1| PREDICTED: thaumatin-like protein 1 isoform X1 [Populus euphratica] Length = 250 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK CP AY+YAYDD+TS FTCPSG ++ ITFCP Sbjct: 217 FKQQCPEAYSYAYDDETSTFTCPSGGNYLITFCP 250 >ref|XP_010531541.1| PREDICTED: thaumatin-like protein 1b [Tarenaya hassleriana] Length = 309 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK+ACP +Y+YAYDDKTS +TC SG+D+ ITFCP Sbjct: 219 FKHACPRSYSYAYDDKTSTYTCASGADYVITFCP 252 >gb|AHY84684.1| thaumatin-like protein [Populus szechuanica] Length = 245 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 317 FKNACPSAYTYAYDDKTSIFTCPSGSDFRITFCP 216 FK CP AY+YAYDDK+S FTCPSG ++ ITFCP Sbjct: 212 FKQQCPQAYSYAYDDKSSTFTCPSGGNYLITFCP 245