BLASTX nr result
ID: Aconitum23_contig00008850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00008850 (446 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010253089.1| PREDICTED: RING-H2 finger protein ATL74-like... 57 7e-06 >ref|XP_010253089.1| PREDICTED: RING-H2 finger protein ATL74-like [Nelumbo nucifera] Length = 197 Score = 56.6 bits (135), Expect = 7e-06 Identities = 36/85 (42%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Frame = +1 Query: 196 MVPGYHNRRWIXXXXXXXXXXXXXAKEIHPHVSHTEEANFDTNMVXXXXXXXXXXXXXXG 375 M P YH R + ++ H S+T EANFDTNMV G Sbjct: 1 MRPQYHPHR-LLLHVESRAPLINGSRSSHGSYSYTSEANFDTNMVIILAALLCTLIFALG 59 Query: 376 LNSIIRCALRCGR--PAETTDEEAA 444 LNSI+RCALRCGR ET DE AA Sbjct: 60 LNSILRCALRCGRRLAFETPDETAA 84