BLASTX nr result
ID: Aconitum23_contig00008130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00008130 (1338 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010230323.1| PREDICTED: serine/arginine-rich splicing fac... 65 2e-07 ref|XP_003567963.1| PREDICTED: serine/arginine-rich splicing fac... 65 2e-07 emb|CDP06673.1| unnamed protein product [Coffea canephora] 64 4e-07 ref|XP_009765001.1| PREDICTED: serine/arginine-rich splicing fac... 63 5e-07 ref|XP_009593629.1| PREDICTED: serine/arginine-rich splicing fac... 63 5e-07 emb|CDM82006.1| unnamed protein product [Triticum aestivum] 62 1e-06 gb|EMS67637.1| Neurofilament heavy polypeptide [Triticum urartu] 62 1e-06 ref|XP_011094784.1| PREDICTED: serine/arginine-rich splicing fac... 61 3e-06 ref|XP_006345686.1| PREDICTED: serine/arginine-rich splicing fac... 61 3e-06 ref|XP_006345685.1| PREDICTED: serine/arginine-rich splicing fac... 61 3e-06 gb|EPS69715.1| hypothetical protein M569_05051 [Genlisea aurea] 61 3e-06 ref|XP_012831955.1| PREDICTED: serine/arginine-rich splicing fac... 60 3e-06 gb|KJB73660.1| hypothetical protein B456_011G242700 [Gossypium r... 60 3e-06 ref|XP_012456084.1| PREDICTED: serine/arginine-rich splicing fac... 60 3e-06 gb|KHF97435.1| Serine/arginine-rich splicing factor 4 [Gossypium... 60 3e-06 ref|XP_010326036.1| PREDICTED: serine/arginine-rich splicing fac... 60 3e-06 ref|XP_012831954.1| PREDICTED: serine/arginine-rich splicing fac... 60 3e-06 ref|XP_004246725.1| PREDICTED: serine/arginine-rich splicing fac... 60 3e-06 ref|XP_006843673.1| PREDICTED: serine/arginine-rich splicing fac... 60 4e-06 gb|KNA06746.1| hypothetical protein SOVF_178190 isoform C [Spina... 59 7e-06 >ref|XP_010230323.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform X1 [Brachypodium distachyon] Length = 320 Score = 64.7 bits (156), Expect = 2e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYD+RDR+G + RLYVG LSSRTRSRDL+ +F RYG Sbjct: 1 MPRYDERDRYGGNTRLYVGRLSSRTRSRDLEDLFGRYG 38 >ref|XP_003567963.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform X2 [Brachypodium distachyon] gi|944066769|gb|KQK02253.1| hypothetical protein BRADI_2g00370 [Brachypodium distachyon] Length = 319 Score = 64.7 bits (156), Expect = 2e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYD+RDR+G + RLYVG LSSRTRSRDL+ +F RYG Sbjct: 1 MPRYDERDRYGGNTRLYVGRLSSRTRSRDLEDLFGRYG 38 >emb|CDP06673.1| unnamed protein product [Coffea canephora] Length = 303 Score = 63.5 bits (153), Expect = 4e-07 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR +GN+ RLYVGHLSSRTRSRDL+ +FSRYG Sbjct: 1 MPRYDDR--YGNTTRLYVGHLSSRTRSRDLEHLFSRYG 36 >ref|XP_009765001.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform X1 [Nicotiana sylvestris] Length = 319 Score = 63.2 bits (152), Expect = 5e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR GNS RLYVGHLSSRTRSRDL+ +FS+YG Sbjct: 1 MPRYDDRS--GNSTRLYVGHLSSRTRSRDLERVFSKYG 36 >ref|XP_009593629.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform X1 [Nicotiana tomentosiformis] Length = 317 Score = 63.2 bits (152), Expect = 5e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR GNS RLYVGHLSSRTRSRDL+ +FS+YG Sbjct: 1 MPRYDDRS--GNSTRLYVGHLSSRTRSRDLERVFSKYG 36 >emb|CDM82006.1| unnamed protein product [Triticum aestivum] Length = 323 Score = 61.6 bits (148), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYD+RDR+G + RLYVG L SRTR+RDL+ +F RYG Sbjct: 1 MPRYDERDRYGGNTRLYVGRLPSRTRTRDLEDLFGRYG 38 >gb|EMS67637.1| Neurofilament heavy polypeptide [Triticum urartu] Length = 431 Score = 61.6 bits (148), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYD+RDR+G + RLYVG L SRTR+RDL+ +F RYG Sbjct: 26 MPRYDERDRYGGNTRLYVGRLPSRTRTRDLEDLFGRYG 63 >ref|XP_011094784.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like [Sesamum indicum] Length = 314 Score = 60.8 bits (146), Expect = 3e-06 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRY+DR +G++ RLYVGHLSSRTRSRDL+ IFSRYG Sbjct: 1 MPRYEDR--YGSTTRLYVGHLSSRTRSRDLEHIFSRYG 36 >ref|XP_006345686.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform X2 [Solanum tuberosum] Length = 314 Score = 60.8 bits (146), Expect = 3e-06 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR GNS RLYVGHLSSRTRSRDL+ FS+YG Sbjct: 1 MPRYDDR--MGNSTRLYVGHLSSRTRSRDLERAFSKYG 36 >ref|XP_006345685.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform X1 [Solanum tuberosum] Length = 315 Score = 60.8 bits (146), Expect = 3e-06 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR GNS RLYVGHLSSRTRSRDL+ FS+YG Sbjct: 1 MPRYDDR--MGNSTRLYVGHLSSRTRSRDLERAFSKYG 36 >gb|EPS69715.1| hypothetical protein M569_05051 [Genlisea aurea] Length = 318 Score = 60.8 bits (146), Expect = 3e-06 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRY+DR +G++ RLYVGHLSSRTRSRDL+ IFSRYG Sbjct: 1 MPRYEDR--YGSTTRLYVGHLSSRTRSRDLEHIFSRYG 36 >ref|XP_012831955.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform X2 [Erythranthe guttatus] Length = 286 Score = 60.5 bits (145), Expect = 3e-06 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRY+DR +G++ RLYVGHLSSRTRSRDL+ +FSRYG Sbjct: 1 MPRYEDR--YGSTTRLYVGHLSSRTRSRDLEHVFSRYG 36 >gb|KJB73660.1| hypothetical protein B456_011G242700 [Gossypium raimondii] Length = 303 Score = 60.5 bits (145), Expect = 3e-06 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR G+ RLYVGHLSSRTRSRDL+ +FSRYG Sbjct: 1 MPRYDDR--RGSGTRLYVGHLSSRTRSRDLEDMFSRYG 36 >ref|XP_012456084.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform X1 [Gossypium raimondii] gi|763806718|gb|KJB73656.1| hypothetical protein B456_011G242700 [Gossypium raimondii] Length = 304 Score = 60.5 bits (145), Expect = 3e-06 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR G+ RLYVGHLSSRTRSRDL+ +FSRYG Sbjct: 1 MPRYDDR--RGSGTRLYVGHLSSRTRSRDLEDMFSRYG 36 >gb|KHF97435.1| Serine/arginine-rich splicing factor 4 [Gossypium arboreum] Length = 319 Score = 60.5 bits (145), Expect = 3e-06 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR G+ RLYVGHLSSRTRSRDL+ +FSRYG Sbjct: 1 MPRYDDR--RGSGTRLYVGHLSSRTRSRDLEDMFSRYG 36 >ref|XP_010326036.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform X2 [Solanum lycopersicum] Length = 314 Score = 60.5 bits (145), Expect = 3e-06 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR GNS RLYVGHLSSRTRSRDL+ FS+YG Sbjct: 1 MPRYDDRV--GNSTRLYVGHLSSRTRSRDLERAFSKYG 36 >ref|XP_012831954.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform X1 [Erythranthe guttatus] gi|604342635|gb|EYU41659.1| hypothetical protein MIMGU_mgv1a011263mg [Erythranthe guttata] Length = 287 Score = 60.5 bits (145), Expect = 3e-06 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRY+DR +G++ RLYVGHLSSRTRSRDL+ +FSRYG Sbjct: 1 MPRYEDR--YGSTTRLYVGHLSSRTRSRDLEHVFSRYG 36 >ref|XP_004246725.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform X1 [Solanum lycopersicum] Length = 315 Score = 60.5 bits (145), Expect = 3e-06 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR GNS RLYVGHLSSRTRSRDL+ FS+YG Sbjct: 1 MPRYDDRV--GNSTRLYVGHLSSRTRSRDLERAFSKYG 36 >ref|XP_006843673.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 [Amborella trichopoda] gi|548846041|gb|ERN05348.1| hypothetical protein AMTR_s00007p00189640 [Amborella trichopoda] Length = 320 Score = 60.1 bits (144), Expect = 4e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 116 MPRYDDRDRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRYDDR +G+S RLYVG LSSRTRSRDL+ +FSRYG Sbjct: 1 MPRYDDR--YGSSTRLYVGRLSSRTRSRDLEDLFSRYG 36 >gb|KNA06746.1| hypothetical protein SOVF_178190 isoform C [Spinacia oleracea] Length = 249 Score = 59.3 bits (142), Expect = 7e-06 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 6/44 (13%) Frame = -2 Query: 116 MPRYDDR------DRHGNSARLYVGHLSSRTRSRDLDGIFSRYG 3 MPRY DR DRHG+ RLYVG LSSRTR+ DLD +FSRYG Sbjct: 1 MPRYGDRGDRGDRDRHGSGTRLYVGRLSSRTRTHDLDDLFSRYG 44