BLASTX nr result
ID: Aconitum23_contig00008016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00008016 (316 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145026.1| PREDICTED: putative invertase inhibitor [Cuc... 63 8e-08 ref|XP_008460048.1| PREDICTED: putative invertase inhibitor [Cuc... 59 2e-06 ref|XP_007052414.1| Plant invertase/pectin methylesterase inhibi... 56 9e-06 >ref|XP_004145026.1| PREDICTED: putative invertase inhibitor [Cucumis sativus] gi|700191091|gb|KGN46295.1| hypothetical protein Csa_6G080380 [Cucumis sativus] Length = 188 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 314 TTCEDGFKEKKGTKSPLRKRDADMFELGAISLSIVAML 201 TTCEDGFKE+KG SPL+KRD D FELGAI+LSI+++L Sbjct: 150 TTCEDGFKERKGVASPLKKRDGDAFELGAIALSIMSLL 187 >ref|XP_008460048.1| PREDICTED: putative invertase inhibitor [Cucumis melo] Length = 188 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 314 TTCEDGFKEKKGTKSPLRKRDADMFELGAISLSIVAML 201 TTCEDGFKE+KG SPL+KRD + FELGAI LSI++++ Sbjct: 150 TTCEDGFKERKGVASPLKKRDENAFELGAIVLSIMSLV 187 >ref|XP_007052414.1| Plant invertase/pectin methylesterase inhibitor superfamily protein [Theobroma cacao] gi|508704675|gb|EOX96571.1| Plant invertase/pectin methylesterase inhibitor superfamily protein [Theobroma cacao] Length = 189 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 314 TTCEDGFKEKKGTKSPLRKRDADMFELGAISLSIVAMLAKN 192 TTCEDGFKEK+G SPL KR+ + F+L AIS+SIV ML N Sbjct: 149 TTCEDGFKEKEGVVSPLTKRNNNTFQLSAISISIVNMLRMN 189