BLASTX nr result
ID: Aconitum23_contig00006491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00006491 (374 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011461203.1| PREDICTED: trafficking protein particle comp... 57 7e-06 ref|XP_009771163.1| PREDICTED: trafficking protein particle comp... 57 7e-06 ref|XP_009771161.1| PREDICTED: trafficking protein particle comp... 57 7e-06 ref|XP_009793611.1| PREDICTED: trafficking protein particle comp... 57 7e-06 ref|XP_009613314.1| PREDICTED: trafficking protein particle comp... 57 7e-06 ref|XP_009366158.1| PREDICTED: trafficking protein particle comp... 57 7e-06 emb|CDP10209.1| unnamed protein product [Coffea canephora] 57 7e-06 ref|XP_008343906.1| PREDICTED: LOW QUALITY PROTEIN: trafficking ... 57 7e-06 ref|XP_008384520.1| PREDICTED: trafficking protein particle comp... 57 7e-06 ref|XP_010047127.1| PREDICTED: trafficking protein particle comp... 57 7e-06 ref|XP_006473978.1| PREDICTED: trafficking protein particle comp... 57 7e-06 ref|XP_006453660.1| hypothetical protein CICLE_v10009392mg [Citr... 57 7e-06 ref|XP_007204907.1| hypothetical protein PRUPE_ppa011818mg [Prun... 57 7e-06 >ref|XP_011461203.1| PREDICTED: trafficking protein particle complex subunit 5, partial [Fragaria vesca subsp. vesca] Length = 174 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 140 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 174 >ref|XP_009771163.1| PREDICTED: trafficking protein particle complex subunit 5-like isoform X2 [Nicotiana sylvestris] Length = 173 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 139 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 173 >ref|XP_009771161.1| PREDICTED: trafficking protein particle complex subunit 5-like isoform X1 [Nicotiana sylvestris] gi|698557940|ref|XP_009771162.1| PREDICTED: trafficking protein particle complex subunit 5-like isoform X1 [Nicotiana sylvestris] Length = 188 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 154 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 188 >ref|XP_009793611.1| PREDICTED: trafficking protein particle complex subunit 5 [Nicotiana sylvestris] Length = 194 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 160 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 194 >ref|XP_009613314.1| PREDICTED: trafficking protein particle complex subunit 5 [Nicotiana tomentosiformis] Length = 194 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 160 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 194 >ref|XP_009366158.1| PREDICTED: trafficking protein particle complex subunit 5 [Pyrus x bretschneideri] Length = 194 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 160 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 194 >emb|CDP10209.1| unnamed protein product [Coffea canephora] Length = 194 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 160 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 194 >ref|XP_008343906.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle complex subunit 5-like [Malus domestica] Length = 194 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 160 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 194 >ref|XP_008384520.1| PREDICTED: trafficking protein particle complex subunit 5-like [Malus domestica] Length = 194 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 160 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 194 >ref|XP_010047127.1| PREDICTED: trafficking protein particle complex subunit 5 [Eucalyptus grandis] gi|629114252|gb|KCW78927.1| hypothetical protein EUGRSUZ_C00362 [Eucalyptus grandis] Length = 194 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 160 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 194 >ref|XP_006473978.1| PREDICTED: trafficking protein particle complex subunit 5-like [Citrus sinensis] gi|641840498|gb|KDO59418.1| hypothetical protein CISIN_1g026545mg [Citrus sinensis] Length = 194 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 160 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 194 >ref|XP_006453660.1| hypothetical protein CICLE_v10009392mg [Citrus clementina] gi|557556886|gb|ESR66900.1| hypothetical protein CICLE_v10009392mg [Citrus clementina] Length = 222 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 188 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 222 >ref|XP_007204907.1| hypothetical protein PRUPE_ppa011818mg [Prunus persica] gi|645275725|ref|XP_008242956.1| PREDICTED: trafficking protein particle complex subunit 5 [Prunus mume] gi|462400438|gb|EMJ06106.1| hypothetical protein PRUPE_ppa011818mg [Prunus persica] Length = 194 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 374 VVAAHFVPVEGQLGP*TIILIKFTEEVLRREARLG 270 VV AHFVPVEGQ P T ILIKF EEVLRREARLG Sbjct: 160 VVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 194