BLASTX nr result
ID: Aconitum23_contig00005665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00005665 (347 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008229381.1| PREDICTED: citrate synthase, glyoxysomal [Pr... 96 1e-17 ref|XP_007217210.1| hypothetical protein PRUPE_ppa004363mg [Prun... 96 1e-17 ref|XP_009339543.1| PREDICTED: citrate synthase, glyoxysomal [Py... 95 2e-17 ref|XP_008353644.1| PREDICTED: citrate synthase, glyoxysomal [Ma... 95 2e-17 ref|XP_011007678.1| PREDICTED: citrate synthase, glyoxysomal [Po... 92 2e-16 ref|XP_008812537.1| PREDICTED: citrate synthase, glyoxysomal [Ph... 91 3e-16 ref|XP_002284064.1| PREDICTED: citrate synthase, glyoxysomal [Vi... 91 3e-16 gb|KMT01774.1| hypothetical protein BVRB_9g210550 [Beta vulgaris... 91 3e-16 ref|XP_010689947.1| PREDICTED: citrate synthase, glyoxysomal [Be... 91 3e-16 ref|XP_002322875.1| Citrate synthase family protein [Populus tri... 90 6e-16 ref|XP_010915459.1| PREDICTED: citrate synthase, glyoxysomal-lik... 90 7e-16 ref|XP_008380247.1| PREDICTED: citrate synthase, glyoxysomal [Ma... 90 7e-16 ref|XP_006847773.1| PREDICTED: citrate synthase, glyoxysomal [Am... 90 7e-16 ref|XP_002881873.1| hypothetical protein ARALYDRAFT_483376 [Arab... 90 7e-16 ref|XP_010925583.1| PREDICTED: citrate synthase, glyoxysomal-lik... 89 1e-15 ref|XP_009421277.1| PREDICTED: citrate synthase 3, peroxisomal-l... 89 1e-15 ref|XP_008794152.1| PREDICTED: citrate synthase, glyoxysomal-lik... 89 1e-15 ref|XP_011082955.1| PREDICTED: citrate synthase, glyoxysomal [Se... 89 1e-15 ref|XP_010517820.1| PREDICTED: citrate synthase 3, peroxisomal-l... 89 1e-15 ref|XP_008456386.1| PREDICTED: citrate synthase, glyoxysomal [Cu... 89 2e-15 >ref|XP_008229381.1| PREDICTED: citrate synthase, glyoxysomal [Prunus mume] Length = 514 Score = 95.9 bits (237), Expect = 1e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHY+PPRER+VT +SDKL QVSVSNA+RRRLAGS Sbjct: 461 DPDTKIMRPQQVYTGNWLRHYIPPRERIVTSDSDKLSQVSVSNASRRRLAGS 512 >ref|XP_007217210.1| hypothetical protein PRUPE_ppa004363mg [Prunus persica] gi|462413360|gb|EMJ18409.1| hypothetical protein PRUPE_ppa004363mg [Prunus persica] Length = 514 Score = 95.9 bits (237), Expect = 1e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHY+PPRER+VT +SDKL QVSVSNA+RRRLAGS Sbjct: 461 DPDTKIMRPQQVYTGNWLRHYIPPRERIVTSDSDKLSQVSVSNASRRRLAGS 512 >ref|XP_009339543.1| PREDICTED: citrate synthase, glyoxysomal [Pyrus x bretschneideri] Length = 512 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHY+PPRER+VT ++DKL QVSVSNA+RRRLAGS Sbjct: 459 DPDTKIMRPQQVYTGNWLRHYIPPRERIVTSDADKLSQVSVSNASRRRLAGS 510 >ref|XP_008353644.1| PREDICTED: citrate synthase, glyoxysomal [Malus domestica] Length = 512 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHY+PPRER+VT ++DKL QVSVSNA+RRRLAGS Sbjct: 459 DPDTKIMRPQQVYTGNWLRHYIPPRERIVTSDADKLSQVSVSNASRRRLAGS 510 >ref|XP_011007678.1| PREDICTED: citrate synthase, glyoxysomal [Populus euphratica] Length = 508 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY GEWLRHYMP +ER+V ++DKLGQVS+SNA+RRRLAGS Sbjct: 455 DPDTKIMRPQQVYTGEWLRHYMPLKERMVQTDADKLGQVSISNASRRRLAGS 506 >ref|XP_008812537.1| PREDICTED: citrate synthase, glyoxysomal [Phoenix dactylifera] Length = 518 Score = 91.3 bits (225), Expect = 3e-16 Identities = 39/52 (75%), Positives = 48/52 (92%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHYMPP+ER ++ E+DKLGQ+++SNATRRRL+GS Sbjct: 465 DPDTKIMRPQQVYTGAWLRHYMPPKERTLSAETDKLGQLAISNATRRRLSGS 516 >ref|XP_002284064.1| PREDICTED: citrate synthase, glyoxysomal [Vitis vinifera] gi|296086334|emb|CBI31775.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 91.3 bits (225), Expect = 3e-16 Identities = 40/52 (76%), Positives = 49/52 (94%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY GEWLRH+MP +ER+++ E+D+LGQVS+SNATRRRLAGS Sbjct: 459 DPDTKIMRPQQVYTGEWLRHFMPVKERMMSAEADRLGQVSISNATRRRLAGS 510 >gb|KMT01774.1| hypothetical protein BVRB_9g210550 [Beta vulgaris subsp. vulgaris] Length = 178 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY GEWLRHYMP +ER+V+ DKLGQVSVSNATRRRL+GS Sbjct: 125 DPDTKIMRPQQVYTGEWLRHYMPLKERMVSSGVDKLGQVSVSNATRRRLSGS 176 >ref|XP_010689947.1| PREDICTED: citrate synthase, glyoxysomal [Beta vulgaris subsp. vulgaris] Length = 520 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY GEWLRHYMP +ER+V+ DKLGQVSVSNATRRRL+GS Sbjct: 467 DPDTKIMRPQQVYTGEWLRHYMPLKERMVSSGVDKLGQVSVSNATRRRLSGS 518 >ref|XP_002322875.1| Citrate synthase family protein [Populus trichocarpa] gi|222867505|gb|EEF04636.1| Citrate synthase family protein [Populus trichocarpa] Length = 508 Score = 90.1 bits (222), Expect = 6e-16 Identities = 39/52 (75%), Positives = 48/52 (92%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY GEWLRHYMP +ER++ ++D+LGQVS+SNA+RRRLAGS Sbjct: 455 DPDTKIMRPQQVYTGEWLRHYMPLKERMIQTDADRLGQVSISNASRRRLAGS 506 >ref|XP_010915459.1| PREDICTED: citrate synthase, glyoxysomal-like [Elaeis guineensis] Length = 516 Score = 89.7 bits (221), Expect = 7e-16 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHY P RER+V+ E+D+LGQV+VSNATRRRLAGS Sbjct: 463 DPDTKIMRPQQVYTGVWLRHYAPVRERLVSKEADRLGQVAVSNATRRRLAGS 514 >ref|XP_008380247.1| PREDICTED: citrate synthase, glyoxysomal [Malus domestica] Length = 514 Score = 89.7 bits (221), Expect = 7e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHY+PPRER+V + DKL QVSVSNA+RRRLAG+ Sbjct: 461 DPDTKIMRPQQVYTGNWLRHYIPPRERIVPGDVDKLSQVSVSNASRRRLAGT 512 >ref|XP_006847773.1| PREDICTED: citrate synthase, glyoxysomal [Amborella trichopoda] gi|769808072|ref|XP_011624600.1| PREDICTED: citrate synthase, glyoxysomal [Amborella trichopoda] gi|769808074|ref|XP_011624601.1| PREDICTED: citrate synthase, glyoxysomal [Amborella trichopoda] gi|769808077|ref|XP_011624602.1| PREDICTED: citrate synthase, glyoxysomal [Amborella trichopoda] gi|548851074|gb|ERN09354.1| hypothetical protein AMTR_s00162p00052420 [Amborella trichopoda] Length = 510 Score = 89.7 bits (221), Expect = 7e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHYMP +ER+ E+D+LGQVS+SNATRRRLAGS Sbjct: 457 DPDTKIMRPQQVYTGVWLRHYMPLKERLAASEADRLGQVSISNATRRRLAGS 508 >ref|XP_002881873.1| hypothetical protein ARALYDRAFT_483376 [Arabidopsis lyrata subsp. lyrata] gi|297327712|gb|EFH58132.1| hypothetical protein ARALYDRAFT_483376 [Arabidopsis lyrata subsp. lyrata] Length = 509 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 3/55 (5%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTD---ESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHY P RER+VTD ESDKLGQVS SNA+RRRLAGS Sbjct: 453 DPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVSTSNASRRRLAGS 507 >ref|XP_010925583.1| PREDICTED: citrate synthase, glyoxysomal-like [Elaeis guineensis] Length = 518 Score = 89.4 bits (220), Expect = 1e-15 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHY P RER+V++E+D+LGQV+VSNATRRRLAG+ Sbjct: 465 DPDTKIMRPQQVYTGVWLRHYTPVRERLVSNEADRLGQVAVSNATRRRLAGA 516 >ref|XP_009421277.1| PREDICTED: citrate synthase 3, peroxisomal-like [Musa acuminata subsp. malaccensis] Length = 513 Score = 89.4 bits (220), Expect = 1e-15 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGSK 189 DPDTKIMRPQ+VY GEW RHY P RER+V++ +DKLGQV VSNA+RRRLAGS+ Sbjct: 460 DPDTKIMRPQQVYTGEWFRHYTPVRERMVSETTDKLGQVGVSNASRRRLAGSQ 512 >ref|XP_008794152.1| PREDICTED: citrate synthase, glyoxysomal-like [Phoenix dactylifera] Length = 517 Score = 89.4 bits (220), Expect = 1e-15 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHY P RER++++E+DKLGQV+VSNAT+RRLAGS Sbjct: 464 DPDTKIMRPQQVYTGVWLRHYTPVRERLMSNEADKLGQVAVSNATKRRLAGS 515 >ref|XP_011082955.1| PREDICTED: citrate synthase, glyoxysomal [Sesamum indicum] Length = 512 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/52 (78%), Positives = 45/52 (86%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRP +VY G WLRHYMP +ER++T DKLGQVSVSNATRRRLAGS Sbjct: 459 DPDTKIMRPAQVYTGVWLRHYMPLKERMITKAEDKLGQVSVSNATRRRLAGS 510 >ref|XP_010517820.1| PREDICTED: citrate synthase 3, peroxisomal-like [Camelina sativa] Length = 511 Score = 89.0 bits (219), Expect = 1e-15 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 3/55 (5%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTD---ESDKLGQVSVSNATRRRLAGS 192 DPDTKIMRPQ+VY G WLRHY P RER++TD ESDKLGQVS SNATRRRLAG+ Sbjct: 455 DPDTKIMRPQQVYTGVWLRHYTPVRERIMTDESKESDKLGQVSTSNATRRRLAGT 509 >ref|XP_008456386.1| PREDICTED: citrate synthase, glyoxysomal [Cucumis melo] Length = 511 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/52 (73%), Positives = 49/52 (94%) Frame = -1 Query: 347 DPDTKIMRPQEVYVGEWLRHYMPPRERVVTDESDKLGQVSVSNATRRRLAGS 192 DPDTKI+RPQ+VY GEWLRHY+PP+ER+V ++D+LGQVSVSNA++RRL+GS Sbjct: 458 DPDTKIIRPQQVYTGEWLRHYIPPKERLVPAKADRLGQVSVSNASKRRLSGS 509