BLASTX nr result
ID: Aconitum23_contig00005283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00005283 (334 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522859.1| Pectinesterase-2 precursor, putative [Ricinu... 56 9e-06 >ref|XP_002522859.1| Pectinesterase-2 precursor, putative [Ricinus communis] gi|223537943|gb|EEF39557.1| Pectinesterase-2 precursor, putative [Ricinus communis] Length = 553 Score = 56.2 bits (134), Expect = 9e-06 Identities = 34/86 (39%), Positives = 44/86 (51%) Frame = -2 Query: 258 DLDDAKTWLSGVLTNHVTCIDGLSLHSSLTPKLHLQSHLQDXXXXXXXXXXXXXXXXXSN 79 D DDA TWLSGVLTNHVTC+DG+ LT + +++ +QD SN Sbjct: 154 DADDAHTWLSGVLTNHVTCLDGI----VLTGQQSIKNLMQDLISRTRTSLAVLASLSASN 209 Query: 78 EQQHRDMIDTPLDGNMPFWITPADQK 1 + R PL G P+WI D+K Sbjct: 210 KGNLR-----PLSGGFPWWIRVKDRK 230