BLASTX nr result
ID: Aconitum23_contig00004648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00004648 (357 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534948.1| conserved hypothetical protein [Ricinus comm... 72 2e-10 emb|CBI36501.3| unnamed protein product [Vitis vinifera] 71 4e-10 gb|KCW56102.1| hypothetical protein EUGRSUZ_I01856 [Eucalyptus g... 63 8e-08 >ref|XP_002534948.1| conserved hypothetical protein [Ricinus communis] gi|223524314|gb|EEF27433.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 318 SLPRGEGSLTYGFQAWREAKGLDFTYDQISGQP 220 SLPRGEGSLTYGFQAWR+AKGLDFTYDQISGQP Sbjct: 82 SLPRGEGSLTYGFQAWRKAKGLDFTYDQISGQP 114 >emb|CBI36501.3| unnamed protein product [Vitis vinifera] Length = 274 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 318 SLPRGEGSLTYGFQAWREAKGLDFTYDQISGQP 220 SLP+GEGSLTYGFQAWRE KGLDFTYDQISGQP Sbjct: 242 SLPKGEGSLTYGFQAWREVKGLDFTYDQISGQP 274 >gb|KCW56102.1| hypothetical protein EUGRSUZ_I01856 [Eucalyptus grandis] Length = 217 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 306 GEGSLTYGFQAWREAKGLDFTYDQISGQ 223 GEGSLTYGFQAWREAKGLDFTYDQISGQ Sbjct: 189 GEGSLTYGFQAWREAKGLDFTYDQISGQ 216