BLASTX nr result
ID: Aconitum23_contig00003324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00003324 (563 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008239502.1| PREDICTED: neurofilament medium polypeptide ... 64 4e-08 ref|XP_002511150.1| metal ion binding protein, putative [Ricinus... 64 4e-08 gb|KJB51186.1| hypothetical protein B456_008G207300 [Gossypium r... 64 6e-08 gb|KJB51185.1| hypothetical protein B456_008G207300 [Gossypium r... 64 6e-08 gb|KJB51184.1| hypothetical protein B456_008G207300 [Gossypium r... 64 6e-08 gb|KJB51183.1| hypothetical protein B456_008G207300 [Gossypium r... 64 6e-08 ref|XP_012439012.1| PREDICTED: cyclic nucleotide-gated cation ch... 64 6e-08 gb|KHG07679.1| superoxide dismutase 1 copper chaperone [Gossypiu... 64 6e-08 ref|XP_012487635.1| PREDICTED: microtubule-associated protein 1B... 62 1e-07 gb|KJB38747.1| hypothetical protein B456_006G272200 [Gossypium r... 62 1e-07 gb|KJB07099.1| hypothetical protein B456_001G057100 [Gossypium r... 62 1e-07 ref|XP_012467708.1| PREDICTED: neurofilament medium polypeptide ... 62 1e-07 ref|XP_010926815.1| PREDICTED: neurofilament medium polypeptide-... 62 2e-07 ref|XP_010927758.1| PREDICTED: neurofilament medium polypeptide-... 61 3e-07 ref|XP_009382886.1| PREDICTED: neurofilament medium polypeptide-... 61 3e-07 ref|XP_008790790.1| PREDICTED: high mobility group nucleosome-bi... 61 3e-07 ref|XP_008356579.1| PREDICTED: neurofilament light polypeptide-l... 61 4e-07 ref|XP_008374229.1| PREDICTED: LOW QUALITY PROTEIN: neurofilamen... 61 4e-07 gb|KNA12451.1| hypothetical protein SOVF_125590 [Spinacia oleracea] 60 9e-07 gb|KDO64424.1| hypothetical protein CISIN_1g019165mg [Citrus sin... 59 1e-06 >ref|XP_008239502.1| PREDICTED: neurofilament medium polypeptide [Prunus mume] Length = 330 Score = 64.3 bits (155), Expect = 4e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y ME YAYPPQIFSDENPNAC +M Sbjct: 297 KNEYYYYPPRYAMEL-YAYPPQIFSDENPNACSVM 330 >ref|XP_002511150.1| metal ion binding protein, putative [Ricinus communis] gi|223550265|gb|EEF51752.1| metal ion binding protein, putative [Ricinus communis] Length = 349 Score = 64.3 bits (155), Expect = 4e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y ME YAYPPQIFSDENPNAC +M Sbjct: 316 KNEYYYYPPRYAMEL-YAYPPQIFSDENPNACSVM 349 >gb|KJB51186.1| hypothetical protein B456_008G207300 [Gossypium raimondii] Length = 330 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y E+ YAYPPQIFSDENPNAC +M Sbjct: 297 KNEYYYYPPRYATEF-YAYPPQIFSDENPNACTVM 330 >gb|KJB51185.1| hypothetical protein B456_008G207300 [Gossypium raimondii] Length = 319 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y E+ YAYPPQIFSDENPNAC +M Sbjct: 286 KNEYYYYPPRYATEF-YAYPPQIFSDENPNACTVM 319 >gb|KJB51184.1| hypothetical protein B456_008G207300 [Gossypium raimondii] Length = 269 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y E+ YAYPPQIFSDENPNAC +M Sbjct: 236 KNEYYYYPPRYATEF-YAYPPQIFSDENPNACTVM 269 >gb|KJB51183.1| hypothetical protein B456_008G207300 [Gossypium raimondii] Length = 188 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y E+ YAYPPQIFSDENPNAC +M Sbjct: 155 KNEYYYYPPRYATEF-YAYPPQIFSDENPNACTVM 188 >ref|XP_012439012.1| PREDICTED: cyclic nucleotide-gated cation channel beta-1-like [Gossypium raimondii] gi|763784111|gb|KJB51182.1| hypothetical protein B456_008G207300 [Gossypium raimondii] Length = 336 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y E+ YAYPPQIFSDENPNAC +M Sbjct: 303 KNEYYYYPPRYATEF-YAYPPQIFSDENPNACTVM 336 >gb|KHG07679.1| superoxide dismutase 1 copper chaperone [Gossypium arboreum] Length = 339 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y E+ YAYPPQIFSDENPNAC +M Sbjct: 306 KNEYYYYPPRYATEF-YAYPPQIFSDENPNACTVM 339 >ref|XP_012487635.1| PREDICTED: microtubule-associated protein 1B-like [Gossypium raimondii] gi|763771533|gb|KJB38748.1| hypothetical protein B456_006G272200 [Gossypium raimondii] Length = 329 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y E+ YAYPPQ+FSDENPNAC +M Sbjct: 296 KNEYYYYPPRYATEF-YAYPPQMFSDENPNACTVM 329 >gb|KJB38747.1| hypothetical protein B456_006G272200 [Gossypium raimondii] Length = 247 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y E+ YAYPPQ+FSDENPNAC +M Sbjct: 214 KNEYYYYPPRYATEF-YAYPPQMFSDENPNACTVM 247 >gb|KJB07099.1| hypothetical protein B456_001G057100 [Gossypium raimondii] gi|763739601|gb|KJB07100.1| hypothetical protein B456_001G057100 [Gossypium raimondii] Length = 319 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y E+ YAYPPQ FSDENPNAC IM Sbjct: 286 KNEFYYYPPRYATEF-YAYPPQYFSDENPNACSIM 319 >ref|XP_012467708.1| PREDICTED: neurofilament medium polypeptide [Gossypium raimondii] gi|763739599|gb|KJB07098.1| hypothetical protein B456_001G057100 [Gossypium raimondii] Length = 332 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YYYPP+Y E+ YAYPPQ FSDENPNAC IM Sbjct: 299 KNEFYYYPPRYATEF-YAYPPQYFSDENPNACSIM 332 >ref|XP_010926815.1| PREDICTED: neurofilament medium polypeptide-like [Elaeis guineensis] Length = 364 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 +NE YYY P+YP+EYAY PPQIFSDENPNAC +M Sbjct: 332 RNEFYYYYPRYPVEYAY--PPQIFSDENPNACIVM 364 >ref|XP_010927758.1| PREDICTED: neurofilament medium polypeptide-like [Elaeis guineensis] Length = 376 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 +NE YYY P+YP+EYAY PPQIFSDENPNAC +M Sbjct: 344 RNEFYYYYPRYPVEYAY--PPQIFSDENPNACAVM 376 >ref|XP_009382886.1| PREDICTED: neurofilament medium polypeptide-like [Musa acuminata subsp. malaccensis] Length = 387 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 +NE YYY P+YP+EYAY PPQIFSDENPNAC +M Sbjct: 355 RNEFYYYYPRYPVEYAY--PPQIFSDENPNACAVM 387 >ref|XP_008790790.1| PREDICTED: high mobility group nucleosome-binding domain-containing protein 5-like [Phoenix dactylifera] Length = 374 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 +NE YYY P+YP+EYAY PPQIFSDENPNAC +M Sbjct: 342 RNEFYYYYPRYPVEYAY--PPQIFSDENPNACAVM 374 >ref|XP_008356579.1| PREDICTED: neurofilament light polypeptide-like, partial [Malus domestica] Length = 160 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YY+PP+Y ME YA+PPQIFSDENPNAC IM Sbjct: 127 KNEYYYHPPRYDMEL-YAHPPQIFSDENPNACSIM 160 >ref|XP_008374229.1| PREDICTED: LOW QUALITY PROTEIN: neurofilament medium polypeptide-like [Malus domestica] Length = 343 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 KNE YY+PP+Y ME YA+PPQIFSDENPNAC IM Sbjct: 310 KNEYYYHPPRYDMEL-YAHPPQIFSDENPNACSIM 343 >gb|KNA12451.1| hypothetical protein SOVF_125590 [Spinacia oleracea] Length = 362 Score = 59.7 bits (143), Expect = 9e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 229 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 +NE Y+YPP+Y E YAYPPQIFSDENPNAC IM Sbjct: 329 RNEFYHYPPRYATEM-YAYPPQIFSDENPNACSIM 362 >gb|KDO64424.1| hypothetical protein CISIN_1g019165mg [Citrus sinensis] Length = 277 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 232 NELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 333 NE YYYP +Y ME YAYPPQIFSDENPNAC +M Sbjct: 245 NEYYYYPQRYAMEM-YAYPPQIFSDENPNACSVM 277