BLASTX nr result
ID: Aconitum23_contig00003120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00003120 (409 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010483473.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 83 9e-14 ref|XP_010443618.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 83 9e-14 ref|XP_006281118.1| hypothetical protein CARUB_v10027149mg [Caps... 83 9e-14 ref|NP_200679.1| cyclophilin ROC7 [Arabidopsis thaliana] gi|7531... 83 9e-14 ref|XP_009120386.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 82 1e-13 ref|XP_006401051.1| hypothetical protein EUTSA_v10014704mg [Eutr... 82 1e-13 ref|XP_002864586.1| hypothetical protein ARALYDRAFT_495994 [Arab... 82 1e-13 ref|XP_013612451.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 81 3e-13 emb|CDY52123.1| BnaA10g29520D [Brassica napus] gi|674953308|emb|... 81 3e-13 ref|XP_013682406.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 4e-13 ref|XP_013630628.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 4e-13 ref|XP_009347261.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 4e-13 ref|XP_013732385.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 4e-13 emb|CDX71155.1| BnaC03g12390D [Brassica napus] 80 4e-13 ref|XP_008358961.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 4e-13 ref|XP_008384800.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 4e-13 ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 4e-13 ref|XP_013460238.1| peptidyl-prolyl cis-trans isomerase [Medicag... 80 4e-13 ref|XP_010454144.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 6e-13 gb|AFN53672.1| peptidyl-prolyl cis-trans isomerase [Linum usitat... 80 6e-13 >ref|XP_010483473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Camelina sativa] Length = 204 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL Sbjct: 164 HVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 204 >ref|XP_010443618.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform X1 [Camelina sativa] gi|727539786|ref|XP_010443619.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform X2 [Camelina sativa] Length = 204 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL Sbjct: 164 HVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 204 >ref|XP_006281118.1| hypothetical protein CARUB_v10027149mg [Capsella rubella] gi|482549822|gb|EOA14016.1| hypothetical protein CARUB_v10027149mg [Capsella rubella] Length = 204 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL Sbjct: 164 HVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 204 >ref|NP_200679.1| cyclophilin ROC7 [Arabidopsis thaliana] gi|75313668|sp|Q9SP02.1|CP20A_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP20-1; Short=PPIase CYP20-1; AltName: Full=Cyclophilin of 20 kDa 1; AltName: Full=Rotamase CYP20-1; AltName: Full=Rotamase cyclophilin-7; Flags: Precursor gi|6180043|gb|AAF05760.1|AF192490_1 cyclophilin [Arabidopsis thaliana] gi|8843791|dbj|BAA97339.1| cyclophilin [Arabidopsis thaliana] gi|15081670|gb|AAK82490.1| AT5g58710/mzn1_160 [Arabidopsis thaliana] gi|20334834|gb|AAM16173.1| AT5g58710/mzn1_160 [Arabidopsis thaliana] gi|21554366|gb|AAM63473.1| cyclophilin ROC7 [Arabidopsis thaliana] gi|332009705|gb|AED97088.1| cyclophilin ROC7 [Arabidopsis thaliana] Length = 204 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL Sbjct: 164 HVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 204 >ref|XP_009120386.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Brassica rapa] Length = 205 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYK+EAEGNQSGTPKSKVVIVDSGELPL Sbjct: 165 HVVFGKVVTGMDVVYKIEAEGNQSGTPKSKVVIVDSGELPL 205 >ref|XP_006401051.1| hypothetical protein EUTSA_v10014704mg [Eutrema salsugineum] gi|557102141|gb|ESQ42504.1| hypothetical protein EUTSA_v10014704mg [Eutrema salsugineum] Length = 204 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYK+EAEGNQSGTPKSKVVIVDSGELPL Sbjct: 164 HVVFGKVVTGMDVVYKIEAEGNQSGTPKSKVVIVDSGELPL 204 >ref|XP_002864586.1| hypothetical protein ARALYDRAFT_495994 [Arabidopsis lyrata subsp. lyrata] gi|297310421|gb|EFH40845.1| hypothetical protein ARALYDRAFT_495994 [Arabidopsis lyrata subsp. lyrata] Length = 204 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYK+EAEGNQSGTPKSKVVIVDSGELPL Sbjct: 164 HVVFGKVVTGMDVVYKIEAEGNQSGTPKSKVVIVDSGELPL 204 >ref|XP_013612451.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Brassica oleracea var. oleracea] gi|923554546|ref|XP_013737727.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Brassica napus] gi|923915282|ref|XP_013727179.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Brassica napus] Length = 205 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV++GMDVVYK+EAEGNQSGTPKSKVVIVDSGELPL Sbjct: 165 HVVFGKVVSGMDVVYKIEAEGNQSGTPKSKVVIVDSGELPL 205 >emb|CDY52123.1| BnaA10g29520D [Brassica napus] gi|674953308|emb|CDX80340.1| BnaC09g34020D [Brassica napus] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV++GMDVVYK+EAEGNQSGTPKSKVVIVDSGELPL Sbjct: 164 HVVFGKVVSGMDVVYKIEAEGNQSGTPKSKVVIVDSGELPL 204 >ref|XP_013682406.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Brassica napus] Length = 201 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYK+EAEG+QSGTPKSKVVIVDSGELPL Sbjct: 161 HVVFGKVVTGMDVVYKIEAEGSQSGTPKSKVVIVDSGELPL 201 >ref|XP_013630628.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Brassica oleracea var. oleracea] Length = 219 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYK+EAEG+QSGTPKSKVVIVDSGELPL Sbjct: 179 HVVFGKVVTGMDVVYKIEAEGSQSGTPKSKVVIVDSGELPL 219 >ref|XP_009347261.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Pyrus x bretschneideri] Length = 204 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKVL+GMDVVYK+EAEGNQSGTPKSKVVI DSGELPL Sbjct: 164 HVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELPL 204 >ref|XP_013732385.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Brassica napus] gi|674872959|emb|CDY61026.1| BnaAnng17350D [Brassica napus] Length = 201 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYK+EAEG+QSGTPKSKVVIVDSGELPL Sbjct: 161 HVVFGKVVTGMDVVYKIEAEGSQSGTPKSKVVIVDSGELPL 201 >emb|CDX71155.1| BnaC03g12390D [Brassica napus] Length = 201 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYK+EAEG+QSGTPKSKVVIVDSGELPL Sbjct: 161 HVVFGKVVTGMDVVYKIEAEGSQSGTPKSKVVIVDSGELPL 201 >ref|XP_008358961.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Malus domestica] Length = 204 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKVL+GMDVVYK+EAEGNQSGTPKSKVVI DSGELPL Sbjct: 164 HVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELPL 204 >ref|XP_008384800.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Malus domestica] Length = 204 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKVL+GMDVVYK+EAEGNQSGTPKSKVVI DSGELPL Sbjct: 164 HVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELPL 204 >ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Cicer arietinum] Length = 204 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKVL+GMDVVYK+EAEGNQSGTPKSKVVI DSGELPL Sbjct: 164 HVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELPL 204 >ref|XP_013460238.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|388493558|gb|AFK34845.1| unknown [Medicago truncatula] gi|657393449|gb|KEH34269.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula] Length = 203 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKVL+GMDVVYK+EAEGNQSGTPKSKVVI DSGELPL Sbjct: 163 HVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELPL 203 >ref|XP_010454144.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Camelina sativa] Length = 204 Score = 80.1 bits (196), Expect = 6e-13 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKV+TGMDVVYKVEAEGNQSGTPKSKVVIVDSGE PL Sbjct: 164 HVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGEHPL 204 >gb|AFN53672.1| peptidyl-prolyl cis-trans isomerase [Linum usitatissimum] Length = 206 Score = 80.1 bits (196), Expect = 6e-13 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 409 HVVFGKVLTGMDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 287 HVVFGKVL+GMDVVYKVEAEG QSGTPKSKVVIVDSGELPL Sbjct: 166 HVVFGKVLSGMDVVYKVEAEGKQSGTPKSKVVIVDSGELPL 206