BLASTX nr result
ID: Aconitum23_contig00003014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00003014 (577 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012462702.1| PREDICTED: auxin-responsive protein IAA16 [G... 80 7e-13 ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-li... 80 7e-13 ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [N... 80 7e-13 ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [N... 80 7e-13 gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tab... 80 7e-13 gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana ta... 80 7e-13 ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobr... 80 7e-13 gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum] 80 7e-13 ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum] gi|36581... 80 7e-13 ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tubero... 80 7e-13 emb|CDP06818.1| unnamed protein product [Coffea canephora] 80 1e-12 ref|XP_012089266.1| PREDICTED: auxin-responsive protein IAA16 [J... 80 1e-12 ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabi... 79 2e-12 ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-li... 79 2e-12 ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-li... 79 2e-12 gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium a... 79 2e-12 ref|XP_009420668.1| PREDICTED: auxin-responsive protein IAA30-li... 79 2e-12 ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-li... 79 2e-12 ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [P... 79 2e-12 gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sin... 79 2e-12 >ref|XP_012462702.1| PREDICTED: auxin-responsive protein IAA16 [Gossypium raimondii] gi|763815673|gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii] Length = 246 Score = 80.1 bits (196), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 210 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 246 >ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera] Length = 252 Score = 80.1 bits (196), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 216 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 252 >ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris] Length = 240 Score = 80.1 bits (196), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 204 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 240 >ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis] Length = 240 Score = 80.1 bits (196), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 204 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 240 >gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum] Length = 240 Score = 80.1 bits (196), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 204 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 240 >gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum] Length = 220 Score = 80.1 bits (196), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 184 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 220 >ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao] gi|508719172|gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao] Length = 249 Score = 80.1 bits (196), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 213 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum] Length = 246 Score = 80.1 bits (196), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 210 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 246 >ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum] gi|365818541|gb|AEX00359.1| IAA16 [Solanum lycopersicum] Length = 251 Score = 80.1 bits (196), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 215 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 251 >ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum] gi|256857790|gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum] Length = 249 Score = 80.1 bits (196), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 213 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >emb|CDP06818.1| unnamed protein product [Coffea canephora] Length = 245 Score = 79.7 bits (195), Expect = 1e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEA+GLAPRAVEKCKNRS Sbjct: 209 DVPWEMFVDSCKRLRIMKGSEAVGLAPRAVEKCKNRS 245 >ref|XP_012089266.1| PREDICTED: auxin-responsive protein IAA16 [Jatropha curcas] gi|643708751|gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas] Length = 248 Score = 79.7 bits (195), Expect = 1e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMF+DSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 212 DVPWEMFIDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 248 >ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis] gi|587905039|gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis] Length = 257 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR+ Sbjct: 221 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRT 257 >ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis] Length = 251 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNRS Sbjct: 215 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 251 >ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana] Length = 235 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 199 DVPWQMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 235 >gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum] Length = 246 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVD+CKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 210 DVPWEMFVDTCKRLRIMKGSEAIGLAPRAVEKCKNRS 246 >ref|XP_009420668.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata subsp. malaccensis] Length = 241 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNRS Sbjct: 205 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 241 >ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata subsp. malaccensis] Length = 243 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNRS Sbjct: 207 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 243 >ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume] Length = 248 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNRS Sbjct: 212 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 248 >gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis] Length = 245 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 577 DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 467 DVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 209 DVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 245