BLASTX nr result
ID: Aconitum21_contig00027550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00027550 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002297971.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002320202.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002318417.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002516697.1| ubiquitin, putative [Ricinus communis] gi|22... 55 5e-06 ref|XP_002523344.1| protein with unknown function [Ricinus commu... 55 6e-06 >ref|XP_002297971.1| predicted protein [Populus trichocarpa] gi|222845229|gb|EEE82776.1| predicted protein [Populus trichocarpa] Length = 583 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 465 LKKESVIEEIVREAKDSVLPEASEDAFLEFISQIMDRRLNQFT 337 L KESVIEEI+REA+DS+LP SE AFLE +S IMD RL++FT Sbjct: 540 LNKESVIEEIIREAEDSLLPGMSEAAFLEAVSNIMDYRLDEFT 582 >ref|XP_002320202.1| predicted protein [Populus trichocarpa] gi|222860975|gb|EEE98517.1| predicted protein [Populus trichocarpa] Length = 326 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 465 LKKESVIEEIVREAKDSVLPEASEDAFLEFISQIMDRRLNQ 343 LKKES+IEEIV+EA+DS LP SE FLE +S IMDRRL++ Sbjct: 280 LKKESIIEEIVQEAQDSTLPVTSEALFLETVSHIMDRRLDE 320 >ref|XP_002318417.1| predicted protein [Populus trichocarpa] gi|222859090|gb|EEE96637.1| predicted protein [Populus trichocarpa] Length = 300 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = -3 Query: 465 LKKESVIEEIVREAKDSVLPEASEDAFLEFISQIMDRRLNQFT 337 +KKESVIE+IV+EA D+VLP +SE AFLE +S IMDRRL++ + Sbjct: 258 VKKESVIEQIVQEAHDAVLPGSSEAAFLEAVSLIMDRRLDKLS 300 >ref|XP_002516697.1| ubiquitin, putative [Ricinus communis] gi|223544192|gb|EEF45716.1| ubiquitin, putative [Ricinus communis] Length = 583 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = -3 Query: 465 LKKESVIEEIVREAKDSVLPEASEDAFLEFISQIMDRRLNQFT 337 +KKES IE I++EA+D+VLPE+SE AFLE ++ IMD RL++ + Sbjct: 540 MKKESAIERIIQEAQDAVLPESSEAAFLECVASIMDHRLDELS 582 >ref|XP_002523344.1| protein with unknown function [Ricinus communis] gi|223537432|gb|EEF39060.1| protein with unknown function [Ricinus communis] Length = 585 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 465 LKKESVIEEIVREAKDSVLPEASEDAFLEFISQIMDRRLNQ 343 LKK S+IEEIV+EA+D VLP SE AFLE +S IMDRRL++ Sbjct: 539 LKKASLIEEIVQEAQDCVLPGTSEVAFLETVSHIMDRRLDE 579