BLASTX nr result
ID: Aconitum21_contig00027484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00027484 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAR13317.1| gag-pol polyprotein [Phaseolus vulgaris] 44 2e-06 >gb|AAR13317.1| gag-pol polyprotein [Phaseolus vulgaris] Length = 1859 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 18/78 (23%), Positives = 44/78 (56%) Frame = +1 Query: 91 RPYADSLEGFTNHKVVVKAVINILVTIEDLSIARIEIVNFLVIDLKSNYNAIFSLPAMLQ 270 +PY + + GF+ +V K I++ T D +++ + +L+++ ++YN + P++ + Sbjct: 681 QPYNEQIVGFSRERVDTKGFIDLYTTFGDDYLSKTINIRYLLVNANTSYNILLGRPSINR 740 Query: 271 FQMVASIPNQRVKFLTQN 324 + + S P+ +KF + N Sbjct: 741 LKAIVSTPHLAMKFPSVN 758 Score = 32.7 bits (73), Expect(2) = 2e-06 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +2 Query: 2 VNRVLIDTGAAKDILYYSLFKEPGLSEAHLAP 97 + +VL+D G++ DILY+ FK+ + EA + P Sbjct: 651 IAKVLVDQGSSVDILYWETFKKMKIPEAEIQP 682