BLASTX nr result
ID: Aconitum21_contig00027283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00027283 (482 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312638.1| predicted protein [Populus trichocarpa] gi|2... 115 4e-24 ref|XP_002514989.1| conserved hypothetical protein [Ricinus comm... 114 1e-23 gb|AAO42108.1| unknown protein [Arabidopsis thaliana] 113 2e-23 ref|NP_564900.1| Remorin family protein [Arabidopsis thaliana] g... 113 2e-23 gb|AAM60869.1| unknown [Arabidopsis thaliana] 113 2e-23 >ref|XP_002312638.1| predicted protein [Populus trichocarpa] gi|222852458|gb|EEE90005.1| predicted protein [Populus trichocarpa] Length = 366 Score = 115 bits (288), Expect = 4e-24 Identities = 57/71 (80%), Positives = 67/71 (94%), Gaps = 1/71 (1%) Frame = -3 Query: 273 M*VKAERLKSRAQEKLSNKLAATRRIAEEKRANAEAKLNEQAARTSEKADYMRRTGHLP- 97 M VKAERLK+RAQE+L+NKLA+T+RIAEEKRANAEAKLNE+A +TSEKAD+MR TGHLP Sbjct: 296 MEVKAERLKARAQERLANKLASTKRIAEEKRANAEAKLNEKAVKTSEKADHMRTTGHLPS 355 Query: 96 SFSFKIPSICW 64 SFSFK+PS+CW Sbjct: 356 SFSFKLPSLCW 366 >ref|XP_002514989.1| conserved hypothetical protein [Ricinus communis] gi|223546040|gb|EEF47543.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 114 bits (284), Expect = 1e-23 Identities = 55/71 (77%), Positives = 67/71 (94%), Gaps = 1/71 (1%) Frame = -3 Query: 273 M*VKAERLKSRAQEKLSNKLAATRRIAEEKRANAEAKLNEQAARTSEKADYMRRTGHLP- 97 M VKAER+K+RAQEKL++KLA T+R+AEEKRANAEAKLNE+A RT+E+ADY+RRTGHLP Sbjct: 288 MEVKAERIKARAQEKLTSKLATTKRMAEEKRANAEAKLNEKAVRTAERADYIRRTGHLPS 347 Query: 96 SFSFKIPSICW 64 SFSFK+PS+CW Sbjct: 348 SFSFKLPSLCW 358 >gb|AAO42108.1| unknown protein [Arabidopsis thaliana] Length = 210 Score = 113 bits (282), Expect = 2e-23 Identities = 56/73 (76%), Positives = 67/73 (91%), Gaps = 3/73 (4%) Frame = -3 Query: 273 M*VKAERLKSRAQEKLSNKLAATRRIAEEKRANAEAKLNEQAARTSEKADYMRRTGHLP- 97 M VKAER+K+RA+EKL+NKLAAT+RIAEE+RANAEAKLNE+A +TSEKADY+RR+GHLP Sbjct: 136 MEVKAERMKARAEEKLANKLAATKRIAEERRANAEAKLNEKAVKTSEKADYIRRSGHLPS 195 Query: 96 --SFSFKIPSICW 64 SFSFK+PS CW Sbjct: 196 SFSFSFKLPSRCW 208 >ref|NP_564900.1| Remorin family protein [Arabidopsis thaliana] gi|11072019|gb|AAG28898.1|AC008113_14 F12A21.28 [Arabidopsis thaliana] gi|12324673|gb|AAG52296.1|AC011020_3 unknown protein [Arabidopsis thaliana] gi|332196547|gb|AEE34668.1| Remorin family protein [Arabidopsis thaliana] Length = 347 Score = 113 bits (282), Expect = 2e-23 Identities = 56/73 (76%), Positives = 67/73 (91%), Gaps = 3/73 (4%) Frame = -3 Query: 273 M*VKAERLKSRAQEKLSNKLAATRRIAEEKRANAEAKLNEQAARTSEKADYMRRTGHLP- 97 M VKAER+K+RA+EKL+NKLAAT+RIAEE+RANAEAKLNE+A +TSEKADY+RR+GHLP Sbjct: 273 MEVKAERMKARAEEKLANKLAATKRIAEERRANAEAKLNEKAVKTSEKADYIRRSGHLPS 332 Query: 96 --SFSFKIPSICW 64 SFSFK+PS CW Sbjct: 333 SFSFSFKLPSRCW 345 >gb|AAM60869.1| unknown [Arabidopsis thaliana] Length = 347 Score = 113 bits (282), Expect = 2e-23 Identities = 56/73 (76%), Positives = 67/73 (91%), Gaps = 3/73 (4%) Frame = -3 Query: 273 M*VKAERLKSRAQEKLSNKLAATRRIAEEKRANAEAKLNEQAARTSEKADYMRRTGHLP- 97 M VKAER+K+RA+EKL+NKLAAT+RIAEE+RANAEAKLNE+A +TSEKADY+RR+GHLP Sbjct: 273 MEVKAERMKARAEEKLANKLAATKRIAEERRANAEAKLNEKAVKTSEKADYIRRSGHLPS 332 Query: 96 --SFSFKIPSICW 64 SFSFK+PS CW Sbjct: 333 SFSFSFKLPSRCW 345