BLASTX nr result
ID: Aconitum21_contig00027152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00027152 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI33346.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002285639.1| PREDICTED: probable pectate lyase 15 [Vitis ... 56 3e-06 emb|CAN78491.1| hypothetical protein VITISV_004934 [Vitis vinifera] 56 3e-06 gb|AAM61584.1| putative pectate lyase [Arabidopsis thaliana] 55 8e-06 ref|NP_187357.1| putative pectate lyase 8 [Arabidopsis thaliana]... 55 8e-06 >emb|CBI33346.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 EMYTIGGSASPTINSQRNRCLAPVSPFAKEV 95 EMY IGGSASPTINSQ NR LAPV+PFAKEV Sbjct: 328 EMYAIGGSASPTINSQGNRYLAPVNPFAKEV 358 >ref|XP_002285639.1| PREDICTED: probable pectate lyase 15 [Vitis vinifera] Length = 432 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 EMYTIGGSASPTINSQRNRCLAPVSPFAKEV 95 EMY IGGSASPTINSQ NR LAPV+PFAKEV Sbjct: 330 EMYAIGGSASPTINSQGNRYLAPVNPFAKEV 360 >emb|CAN78491.1| hypothetical protein VITISV_004934 [Vitis vinifera] Length = 418 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 EMYTIGGSASPTINSQRNRCLAPVSPFAKEV 95 EMY IGGSASPTINSQ NR LAPV+PFAKEV Sbjct: 316 EMYAIGGSASPTINSQGNRYLAPVNPFAKEV 346 >gb|AAM61584.1| putative pectate lyase [Arabidopsis thaliana] Length = 416 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 3 EMYTIGGSASPTINSQRNRCLAPVSPFAKEV 95 EMY IGGSA PTINSQ NR LAPV+PFAKEV Sbjct: 314 EMYAIGGSAGPTINSQGNRFLAPVNPFAKEV 344 >ref|NP_187357.1| putative pectate lyase 8 [Arabidopsis thaliana] gi|32129848|sp|Q9M8Z8.1|PEL8_ARATH RecName: Full=Probable pectate lyase 8; Flags: Precursor gi|6729008|gb|AAF27005.1|AC016827_16 putative pectate lyase [Arabidopsis thaliana] gi|222424522|dbj|BAH20216.1| AT3G07010 [Arabidopsis thaliana] gi|332640967|gb|AEE74488.1| putative pectate lyase 8 [Arabidopsis thaliana] Length = 416 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 3 EMYTIGGSASPTINSQRNRCLAPVSPFAKEV 95 EMY IGGSA PTINSQ NR LAPV+PFAKEV Sbjct: 314 EMYAIGGSAGPTINSQGNRFLAPVNPFAKEV 344