BLASTX nr result
ID: Aconitum21_contig00027087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00027087 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_08745945.1| ribonuclease H [Vibrio scophthalmi LMG 19158]... 62 4e-08 ref|ZP_08752535.1| ribonuclease H [Vibrio sp. N418] gi|342798172... 62 4e-08 ref|ZP_01159519.1| hypothetical ribonuclease HI [Photobacterium ... 62 4e-08 ref|ZP_01234801.1| hypothetical ribonuclease HI [Photobacterium ... 62 5e-08 ref|ZP_08745028.1| ribonuclease H [Vibrio ichthyoenteri ATCC 700... 61 8e-08 >ref|ZP_08745945.1| ribonuclease H [Vibrio scophthalmi LMG 19158] gi|342807522|gb|EGU42709.1| ribonuclease H [Vibrio scophthalmi LMG 19158] Length = 260 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = +3 Query: 84 MLNKFYVV*VGRQPEIYTTWEMCS*QTNKFSGARFKSFPTLEEARRAF 227 M K+YVV GR+ I+TTW C Q +KF+GARFKSFPTL EA AF Sbjct: 1 MATKYYVVWKGRETGIFTTWAQCQAQVDKFAGARFKSFPTLAEAEAAF 48 >ref|ZP_08752535.1| ribonuclease H [Vibrio sp. N418] gi|342798172|gb|EGU33798.1| ribonuclease H [Vibrio sp. N418] Length = 260 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = +3 Query: 84 MLNKFYVV*VGRQPEIYTTWEMCS*QTNKFSGARFKSFPTLEEARRAF 227 M K+YVV GR+ I+TTW C Q +KF+GARFKSFPTL EA AF Sbjct: 1 MATKYYVVWKGRETGIFTTWAQCQAQVDKFAGARFKSFPTLAEAEAAF 48 >ref|ZP_01159519.1| hypothetical ribonuclease HI [Photobacterium sp. SKA34] gi|89051190|gb|EAR56646.1| hypothetical ribonuclease HI [Photobacterium sp. SKA34] Length = 255 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = +3 Query: 84 MLNKFYVV*VGRQPEIYTTWEMCS*QTNKFSGARFKSFPTLEEARRAF 227 M KFYVV GR+P IYT W C Q +KF+GA++KSFP+ EEA+ AF Sbjct: 1 MAKKFYVVWQGREPGIYTDWTSCKQQVDKFTGAKYKSFPSQEEAKAAF 48 >ref|ZP_01234801.1| hypothetical ribonuclease HI [Photobacterium angustum S14] gi|90439824|gb|EAS65005.1| hypothetical ribonuclease HI [Photobacterium angustum S14] Length = 255 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = +3 Query: 84 MLNKFYVV*VGRQPEIYTTWEMCS*QTNKFSGARFKSFPTLEEARRAF 227 M KFYVV GR+P IYT W C Q +KF+GA++KSFP+ EEA+ AF Sbjct: 1 MAKKFYVVWQGREPGIYTDWTSCKQQVDKFAGAKYKSFPSQEEAQAAF 48 >ref|ZP_08745028.1| ribonuclease H [Vibrio ichthyoenteri ATCC 700023] gi|342797001|gb|EGU32658.1| ribonuclease H [Vibrio ichthyoenteri ATCC 700023] Length = 282 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = +3 Query: 84 MLNKFYVV*VGRQPEIYTTWEMCS*QTNKFSGARFKSFPTLEEARRAF 227 + K+YVV GR+ I+TTW C Q +KF+GARFKSFPTL EA AF Sbjct: 23 LATKYYVVWKGRETGIFTTWAQCQAQVDKFAGARFKSFPTLAEAEAAF 70