BLASTX nr result
ID: Aconitum21_contig00026388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00026388 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139106.1| PREDICTED: uncharacterized protein LOC101211... 60 2e-07 >ref|XP_004139106.1| PREDICTED: uncharacterized protein LOC101211330 [Cucumis sativus] gi|449485355|ref|XP_004157143.1| PREDICTED: uncharacterized protein LOC101231955 [Cucumis sativus] Length = 171 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +1 Query: 220 MRERMERLVLLPFSIGCASQSSVAV-IQNNNKREIPEPLSSPTRKLGEED 366 MR +MERLVLLPFS+GC S++SVAV IQ+N+ P P+SSPT +ED Sbjct: 1 MRRKMERLVLLPFSVGCISETSVAVGIQHNSTTSKPHPISSPTSSEKDED 50