BLASTX nr result
ID: Aconitum21_contig00025850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00025850 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143481.1| PREDICTED: trafficking protein particle comp... 70 9e-11 ref|XP_004162309.1| PREDICTED: trafficking protein particle comp... 70 9e-11 ref|XP_003602004.1| Tetratricopeptide repeat protein [Medicago t... 66 9e-10 ref|XP_002307110.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-09 ref|XP_002281520.1| PREDICTED: trafficking protein particle comp... 61 2e-09 >ref|XP_004143481.1| PREDICTED: trafficking protein particle complex subunit 12-like [Cucumis sativus] Length = 387 Score = 69.7 bits (169), Expect(2) = 9e-11 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = -1 Query: 172 SLFQMPHGYPIYLSYNVLAQTKLRKYIEAAEDIDTLQDFESSKYKYKSYPDEYPN 8 +L Q PH + YLSYNVLA KLR++ EA ++D+L+D SS+Y+Y+SYP YPN Sbjct: 77 TLLQKPHDHLTYLSYNVLALVKLRRFAEALAELDSLEDLNSSQYRYESYPSVYPN 131 Score = 21.6 bits (44), Expect(2) = 9e-11 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 206 SILDKITRARKLS 168 SILDK+ RAR L+ Sbjct: 65 SILDKVARARALT 77 >ref|XP_004162309.1| PREDICTED: trafficking protein particle complex subunit 12-like, partial [Cucumis sativus] Length = 335 Score = 69.7 bits (169), Expect(2) = 9e-11 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = -1 Query: 172 SLFQMPHGYPIYLSYNVLAQTKLRKYIEAAEDIDTLQDFESSKYKYKSYPDEYPN 8 +L Q PH + YLSYNVLA KLR++ EA ++D+L+D SS+Y+Y+SYP YPN Sbjct: 25 TLLQKPHDHLTYLSYNVLALVKLRRFAEALAELDSLEDLNSSQYRYESYPSVYPN 79 Score = 21.6 bits (44), Expect(2) = 9e-11 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 206 SILDKITRARKLS 168 SILDK+ RAR L+ Sbjct: 13 SILDKVARARALT 25 >ref|XP_003602004.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355491052|gb|AES72255.1| Tetratricopeptide repeat protein [Medicago truncatula] Length = 359 Score = 65.9 bits (159), Expect(2) = 9e-10 Identities = 27/55 (49%), Positives = 42/55 (76%) Frame = -1 Query: 172 SLFQMPHGYPIYLSYNVLAQTKLRKYIEAAEDIDTLQDFESSKYKYKSYPDEYPN 8 SL Q PH + YL++N LA TKLR++ EA+ ++D+++D +SS Y+Y++YP YPN Sbjct: 52 SLLQKPHDHLTYLAFNALAFTKLRRFNEASSELDSVEDLDSSHYRYETYPKVYPN 106 Score = 21.9 bits (45), Expect(2) = 9e-10 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 206 SILDKITRARKLS 168 SI+DK+ RAR LS Sbjct: 40 SIIDKVARARALS 52 >ref|XP_002307110.1| predicted protein [Populus trichocarpa] gi|222856559|gb|EEE94106.1| predicted protein [Populus trichocarpa] Length = 325 Score = 60.8 bits (146), Expect(2) = 1e-09 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = -1 Query: 172 SLFQMPHGYPIYLSYNVLAQTKLRKYIEAAEDIDTLQDFESSKYKYKSYPDEYPN 8 SL PH + YL+Y VL+ TKLR++ EA ++D+L DF S Y+Y++YP YPN Sbjct: 22 SLLNTPHDHLTYLAYIVLSFTKLRRFQEAQTELDSLDDFNSHHYRYETYPKIYPN 76 Score = 26.6 bits (57), Expect(2) = 1e-09 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 230 LRN*NPTLSILDKITRARKLSFPN 159 L N LSILDK+ RAR LS N Sbjct: 2 LANRGSWLSILDKVNRARSLSLLN 25 >ref|XP_002281520.1| PREDICTED: trafficking protein particle complex subunit 12-like [Vitis vinifera] Length = 373 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = -1 Query: 172 SLFQMPHGYPIYLSYNVLAQTKLRKYIEAAEDIDTLQDFESSKYKYKSYPDEYP 11 SL Q PH + Y SYNVLA KLR+Y + +E++ +L+D + S Y+Y+S+PD YP Sbjct: 63 SLLQKPHEHLCYFSYNVLALIKLRRYGDVSEELASLEDLDHSIYQYESHPDVYP 116 Score = 25.4 bits (54), Expect(2) = 2e-09 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 206 SILDKITRARKLS 168 SILDK++RARKLS Sbjct: 51 SILDKVSRARKLS 63