BLASTX nr result
ID: Aconitum21_contig00025840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00025840 (616 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79884.1| hypothetical protein VITISV_002539 [Vitis vinifera] 55 1e-05 >emb|CAN79884.1| hypothetical protein VITISV_002539 [Vitis vinifera] Length = 1453 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = -1 Query: 217 CQLCKEPDHTADKCPHIGHYALSTERLDQHFSNM-SIGEPADPNWYADSGANNHMTPDAS 41 CQ+CK HTAD+C A T +L + F+ S+ ++ +W+ D+GA+ HMTPD S Sbjct: 235 CQICKTEGHTADRCRSRYDRAEPTAQLAEAFTTTCSLSNGSESDWFTDTGASAHMTPDPS 294 Query: 40 QLSNTK 23 QL + Sbjct: 295 QLDKVE 300