BLASTX nr result
ID: Aconitum21_contig00025679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00025679 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC63678.1| putative non-LTR retroelement reverse transcripta... 57 1e-06 emb|CAB72467.1| putative protein [Arabidopsis thaliana] 55 6e-06 >gb|AAC63678.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1216 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 2/83 (2%) Frame = -2 Query: 398 GMLGMQ-MRVLNETACMKHVWNPVTKQDSLWTRWAVKNRLKDNTI*HVG-WPNLCSFIWR 225 G LG+Q +R N+ + +K +W ++ QDSLW +W N LK + +G L S+IWR Sbjct: 593 GGLGLQSLREANKVSSLKLIWRLLSCQDSLWVKWTRMNLLKKESFWSIGTHSTLGSWIWR 652 Query: 224 NVINERNSAKKYISMLIGNG*NT 156 ++ R AK + + + NG NT Sbjct: 653 RLLKHREVAKSFCKIEVNNGVNT 675 >emb|CAB72467.1| putative protein [Arabidopsis thaliana] Length = 762 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 6/87 (6%) Frame = -2 Query: 398 GMLGMQ-MRVLNETACMKHVWNPVTKQDSLWTRWAVKNRLKDNTI*HVGW-----PNLCS 237 G LG++ ++ N+ C+K VW ++ DSLW +W N LK + W NL S Sbjct: 425 GGLGLRSLKEANDVCCLKLVWRIISHGDSLWVKWVEHNLLKR----EIFWIVKENANLGS 480 Query: 236 FIWRNVINERNSAKKYISMLIGNG*NT 156 +IW+ ++ R AK++ +GNG +T Sbjct: 481 WIWKKILKYRGVAKRFCKAEVGNGEST 507