BLASTX nr result
ID: Aconitum21_contig00025540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00025540 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275546.2| PREDICTED: pentatricopeptide repeat-containi... 105 4e-21 emb|CBI27235.3| unnamed protein product [Vitis vinifera] 105 4e-21 ref|XP_002532711.1| pentatricopeptide repeat-containing protein,... 102 4e-20 ref|XP_003547411.1| PREDICTED: pentatricopeptide repeat-containi... 94 9e-18 ref|XP_003594868.1| Pentatricopeptide repeat protein [Medicago t... 88 6e-16 >ref|XP_002275546.2| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Vitis vinifera] Length = 896 Score = 105 bits (262), Expect = 4e-21 Identities = 56/99 (56%), Positives = 68/99 (68%), Gaps = 4/99 (4%) Frame = +2 Query: 101 PTFPKQHHNPPSLTLKTPP----PQPPNSQWLETLRSRTRSGLFQEAISLYIQMVISGTP 268 P+ K +P LT KTPP P + W++ LRSRTRS F+EAIS YI+M +SG Sbjct: 32 PSIQKPTASP--LTSKTPPKPTSPSRSTASWVDALRSRTRSNDFREAISTYIEMTVSGAR 89 Query: 269 PDNFAFPAVLKAVSALHDLNCGKQLHASIIKLGYHSSSV 385 PDNFAFPAVLKAVS L DL G+Q+HA+ +K GY SSSV Sbjct: 90 PDNFAFPAVLKAVSGLQDLKTGEQIHAAAVKFGYGSSSV 128 >emb|CBI27235.3| unnamed protein product [Vitis vinifera] Length = 696 Score = 105 bits (262), Expect = 4e-21 Identities = 56/99 (56%), Positives = 68/99 (68%), Gaps = 4/99 (4%) Frame = +2 Query: 101 PTFPKQHHNPPSLTLKTPP----PQPPNSQWLETLRSRTRSGLFQEAISLYIQMVISGTP 268 P+ K +P LT KTPP P + W++ LRSRTRS F+EAIS YI+M +SG Sbjct: 32 PSIQKPTASP--LTSKTPPKPTSPSRSTASWVDALRSRTRSNDFREAISTYIEMTVSGAR 89 Query: 269 PDNFAFPAVLKAVSALHDLNCGKQLHASIIKLGYHSSSV 385 PDNFAFPAVLKAVS L DL G+Q+HA+ +K GY SSSV Sbjct: 90 PDNFAFPAVLKAVSGLQDLKTGEQIHAAAVKFGYGSSSV 128 >ref|XP_002532711.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527557|gb|EEF29678.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 679 Score = 102 bits (253), Expect = 4e-20 Identities = 49/94 (52%), Positives = 63/94 (67%), Gaps = 5/94 (5%) Frame = +2 Query: 119 HHNPPSLTLKTPPPQP-----PNSQWLETLRSRTRSGLFQEAISLYIQMVISGTPPDNFA 283 H P L PP+P + W+E+LR TRS LF+EAIS Y+ M++SG PD++A Sbjct: 20 HELPTKKFLSHSPPKPISQSRSQASWIESLRFNTRSNLFREAISTYVDMILSGVSPDSYA 79 Query: 284 FPAVLKAVSALHDLNCGKQLHASIIKLGYHSSSV 385 FP VLKAV+ L DLN GKQ+HA ++K GY SSSV Sbjct: 80 FPVVLKAVTGLQDLNLGKQIHAHVVKYGYESSSV 113 >ref|XP_003547411.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Glycine max] Length = 1135 Score = 94.4 bits (233), Expect = 9e-18 Identities = 46/86 (53%), Positives = 60/86 (69%), Gaps = 4/86 (4%) Frame = +2 Query: 125 NPPSLTLKTPPPQPPN----SQWLETLRSRTRSGLFQEAISLYIQMVISGTPPDNFAFPA 292 +P +LTL TPPP SQW++ LRS+T S F++AIS Y M+ + PPDNFAFPA Sbjct: 276 HPLTLTLPTPPPTTVERRSPSQWIDLLRSQTHSSSFRDAISTYAAMLAAPAPPDNFAFPA 335 Query: 293 VLKAVSALHDLNCGKQLHASIIKLGY 370 VLKA +A+HDL GKQ+HA + K G+ Sbjct: 336 VLKAAAAVHDLCLGKQIHAHVFKFGH 361 >ref|XP_003594868.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355483916|gb|AES65119.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 874 Score = 88.2 bits (217), Expect = 6e-16 Identities = 47/99 (47%), Positives = 60/99 (60%), Gaps = 13/99 (13%) Frame = +2 Query: 110 PKQHHNPPS------------LTLKTPPPQPPNSQWLETLRSRTRSG-LFQEAISLYIQM 250 P +HH+PP+ T+ P P S+W+ LRS+T+S F +AIS Y M Sbjct: 19 PNKHHSPPTSSSAITTTTTTTTTVAAEPRLP--SEWVSHLRSQTQSSSTFHQAISTYTNM 76 Query: 251 VISGTPPDNFAFPAVLKAVSALHDLNCGKQLHASIIKLG 367 V +G PPDNFAFPAVLKA + + DLN GKQLHA + K G Sbjct: 77 VTAGVPPDNFAFPAVLKATAGIQDLNLGKQLHAHVFKFG 115