BLASTX nr result
ID: Aconitum21_contig00025093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00025093 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512545.1| S-locus-specific glycoprotein S13 precursor,... 66 3e-09 ref|XP_002281022.2| PREDICTED: G-type lectin S-receptor-like ser... 64 1e-08 ref|XP_002304960.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 emb|CAN63988.1| hypothetical protein VITISV_016156 [Vitis vinifera] 64 2e-08 emb|CAN63987.1| hypothetical protein VITISV_016155 [Vitis vinifera] 64 2e-08 >ref|XP_002512545.1| S-locus-specific glycoprotein S13 precursor, putative [Ricinus communis] gi|223548506|gb|EEF49997.1| S-locus-specific glycoprotein S13 precursor, putative [Ricinus communis] Length = 818 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/60 (50%), Positives = 43/60 (71%) Frame = +2 Query: 218 LVFHNFIFCFAIETISPTQLVTDSESIISLNQTFKLGFFSPGNTTNRRYVGIWYNTLPGE 397 L+F F FC + +TI + +TD + I+S N +F LGFF PGN+++ +Y+GIWYN LPGE Sbjct: 7 LLFLFFPFCLSTDTIKLNESITDRDVIVSRNGSFALGFFRPGNSSH-KYLGIWYNELPGE 65 >ref|XP_002281022.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Vitis vinifera] Length = 1081 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 5/68 (7%) Frame = +2 Query: 203 PFFPF---LVFHNFI--FCFAIETISPTQLVTDSESIISLNQTFKLGFFSPGNTTNRRYV 367 PFF F L+ + FC A +TI+PTQ + D E+++S Q F+LGFFSP N+ N RY+ Sbjct: 5 PFFTFFCSLISSSIFLKFCVASDTITPTQSMVDGETLVSSGQRFELGFFSPENSKN-RYL 63 Query: 368 GIWYNTLP 391 GIWY + P Sbjct: 64 GIWYKSAP 71 >ref|XP_002304960.1| predicted protein [Populus trichocarpa] gi|222847924|gb|EEE85471.1| predicted protein [Populus trichocarpa] Length = 829 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/62 (50%), Positives = 42/62 (67%), Gaps = 4/62 (6%) Frame = +2 Query: 218 LVFHNFIFCF----AIETISPTQLVTDSESIISLNQTFKLGFFSPGNTTNRRYVGIWYNT 385 L+ +FCF A++ I+ +Q + D E+I+S FKLGFFSP N+TN RYVGIWYN Sbjct: 13 LLLFVLLFCFDFGVAVDIITSSQFIKDPEAIVSARNIFKLGFFSPVNSTN-RYVGIWYND 71 Query: 386 LP 391 +P Sbjct: 72 MP 73 >emb|CAN63988.1| hypothetical protein VITISV_016156 [Vitis vinifera] Length = 1272 Score = 63.5 bits (153), Expect = 2e-08 Identities = 34/73 (46%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = +2 Query: 176 SAMDV---KVITPFFPFLVFHNFIFCFAIETISPTQLVTDSESIISLNQTFKLGFFSPGN 346 +AMD+ +T L F FC A TI+ TQ + D E ++S FK+GFFSPGN Sbjct: 177 AAMDIISGTSVTALLLLLYCLCFQFCTATNTITSTQFIKDPEIMVSNGSLFKMGFFSPGN 236 Query: 347 TTNRRYVGIWYNT 385 +T +RY GIWYNT Sbjct: 237 ST-KRYFGIWYNT 248 >emb|CAN63987.1| hypothetical protein VITISV_016155 [Vitis vinifera] Length = 827 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +2 Query: 233 FIFCFAIETISPTQLVTDSESIISLNQTFKLGFFSPGNTTNRRYVGIWYNT 385 F FC A +TI+ TQ + D E+++S FK+GFFSPGN+T +RY GIWYN+ Sbjct: 21 FQFCTATDTITSTQFIKDPETMVSNGSLFKMGFFSPGNST-KRYFGIWYNS 70