BLASTX nr result
ID: Aconitum21_contig00025077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00025077 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521951.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002521951.1| conserved hypothetical protein [Ricinus communis] gi|223538755|gb|EEF40355.1| conserved hypothetical protein [Ricinus communis] Length = 133 Score = 54.7 bits (130), Expect = 8e-06 Identities = 35/86 (40%), Positives = 44/86 (51%), Gaps = 9/86 (10%) Frame = -1 Query: 449 MDKLRMQHSSM----KRQSH-KIKRKPTNIVYIGNPRMFKANNCFEFRQIVQQLTGQHSE 285 M KL Q+ K Q H K K+KP I YI NP + +A N EFR IVQ+LTG+ S+ Sbjct: 1 MGKLSKQYFQQGQLPKSQKHTKNKKKPVKITYISNPTLVRATNASEFRAIVQELTGKDSK 60 Query: 284 P----SFGPTLTTHAEVGTNTPVYTS 219 P T+H E + P Y S Sbjct: 61 VLDTWDPDPYTTSHEEAASQVPNYES 86