BLASTX nr result
ID: Aconitum21_contig00023813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00023813 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004161465.1| PREDICTED: uncharacterized LOC101211599 [Cuc... 60 2e-07 ref|XP_004143878.1| PREDICTED: uncharacterized protein LOC101211... 60 2e-07 ref|XP_002303627.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 gb|AAO64205.1| unknown protein [Arabidopsis thaliana] 57 2e-06 ref|NP_194107.2| Cox19-like CHCH family protein [Arabidopsis tha... 57 2e-06 >ref|XP_004161465.1| PREDICTED: uncharacterized LOC101211599 [Cucumis sativus] Length = 66 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 417 LLNCVTETPYDQEKCLRLLTSLRNCVLKENVKKFQL 310 LLNCVTE+P+DQEKC RLL SLR CVL + VKKF L Sbjct: 17 LLNCVTESPFDQEKCYRLLHSLRECVLSKKVKKFSL 52 >ref|XP_004143878.1| PREDICTED: uncharacterized protein LOC101211599 [Cucumis sativus] Length = 66 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 417 LLNCVTETPYDQEKCLRLLTSLRNCVLKENVKKFQL 310 LLNCVTE+P+DQEKC RLL SLR CVL + VKKF L Sbjct: 17 LLNCVTESPFDQEKCYRLLHSLRECVLSKKVKKFSL 52 >ref|XP_002303627.1| predicted protein [Populus trichocarpa] gi|222841059|gb|EEE78606.1| predicted protein [Populus trichocarpa] Length = 67 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 417 LLNCVTETPYDQEKCLRLLTSLRNCVLKENVKKFQL 310 LLNCV ++PYDQ+KC+RLL +LR CVL + VKKF L Sbjct: 17 LLNCVAQSPYDQDKCVRLLQTLRECVLNKKVKKFSL 52 >gb|AAO64205.1| unknown protein [Arabidopsis thaliana] Length = 92 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 417 LLNCVTETPYDQEKCLRLLTSLRNCVLKENVKKFQL 310 LLNCV E+P+DQEKC+R L SLR CVL + VKKF + Sbjct: 39 LLNCVAESPFDQEKCVRFLQSLRECVLSKKVKKFSI 74 >ref|NP_194107.2| Cox19-like CHCH family protein [Arabidopsis thaliana] gi|332659403|gb|AEE84803.1| Cox19-like CHCH family protein [Arabidopsis thaliana] Length = 116 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 417 LLNCVTETPYDQEKCLRLLTSLRNCVLKENVKKFQL 310 LLNCV E+P+DQEKC+R L SLR CVL + VKKF + Sbjct: 63 LLNCVAESPFDQEKCVRFLQSLRECVLSKKVKKFSI 98