BLASTX nr result
ID: Aconitum21_contig00023741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00023741 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003636830.1| Cytochrome P450 monooxygenase CYP704G7 [Medi... 74 2e-11 ref|XP_003627669.1| Cytochrome P450 monooxygenase CYP704G7 [Medi... 74 2e-11 gb|ABC59095.1| cytochrome P450 monooxygenase CYP704G7 [Medicago ... 73 3e-11 ref|XP_003627663.1| Cytochrome P450 monooxygenase CYP704G7 [Medi... 73 3e-11 emb|CAC10214.1| hypothetical protein [Cicer arietinum] 70 2e-10 >ref|XP_003636830.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula] gi|355502765|gb|AES83968.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula] Length = 512 Score = 73.6 bits (179), Expect = 2e-11 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -3 Query: 118 NSSKKQHHPIAGTIFNQLLNFTRLHHYMTDLARKYKTYR 2 N KK++HP+AGT+FNQ++NF RLHHYMTDLARKY+TYR Sbjct: 41 NMKKKKYHPVAGTVFNQMMNFNRLHHYMTDLARKYRTYR 79 >ref|XP_003627669.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula] gi|358344467|ref|XP_003636311.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula] gi|355502246|gb|AES83449.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula] gi|355521691|gb|AET02145.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula] Length = 506 Score = 73.6 bits (179), Expect = 2e-11 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -3 Query: 118 NSSKKQHHPIAGTIFNQLLNFTRLHHYMTDLARKYKTYR 2 N KK++HP+AGT+FNQ++NF RLHHYMTDLARKY+TYR Sbjct: 35 NMKKKKYHPVAGTVFNQMMNFNRLHHYMTDLARKYRTYR 73 >gb|ABC59095.1| cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula] Length = 513 Score = 72.8 bits (177), Expect = 3e-11 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -3 Query: 109 KKQHHPIAGTIFNQLLNFTRLHHYMTDLARKYKTYR 2 KK++HP+AGT+FNQ++NF RLHHYMTDLARKYKTYR Sbjct: 44 KKKYHPVAGTVFNQMMNFNRLHHYMTDLARKYKTYR 79 >ref|XP_003627663.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula] gi|355521685|gb|AET02139.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula] Length = 507 Score = 72.8 bits (177), Expect = 3e-11 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -3 Query: 109 KKQHHPIAGTIFNQLLNFTRLHHYMTDLARKYKTYR 2 KK++HP+AGT+FNQ++NF RLHHYMTDLARKYKTYR Sbjct: 38 KKKYHPVAGTVFNQMMNFNRLHHYMTDLARKYKTYR 73 >emb|CAC10214.1| hypothetical protein [Cicer arietinum] Length = 149 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 109 KKQHHPIAGTIFNQLLNFTRLHHYMTDLARKYKTYR 2 KK++HP+AGT+FNQ++NF RLHHYMTDLA KYKTYR Sbjct: 49 KKKYHPVAGTVFNQMMNFNRLHHYMTDLAGKYKTYR 84