BLASTX nr result
ID: Aconitum21_contig00023687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00023687 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517451.1| pentatricopeptide repeat-containing protein,... 127 9e-28 emb|CBI35029.3| unnamed protein product [Vitis vinifera] 123 1e-26 ref|XP_002276684.1| PREDICTED: putative pentatricopeptide repeat... 123 1e-26 ref|XP_002877120.1| pentatricopeptide repeat-containing protein ... 115 5e-24 ref|XP_003533068.1| PREDICTED: putative pentatricopeptide repeat... 114 1e-23 >ref|XP_002517451.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543462|gb|EEF44993.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 428 Score = 127 bits (319), Expect = 9e-28 Identities = 55/96 (57%), Positives = 78/96 (81%) Frame = +1 Query: 1 LTSVWGSMLSACNIHRNVEFAELAVEKLLQLEHDNGAEEDVTYVQLSNIYLNAQRSDDAR 180 L SVWG++LS+C H+N E AE AV++LLQLE+ NG EED +VQL NIYL+ R +DA Sbjct: 299 LASVWGAVLSSCRTHKNAELAEFAVQELLQLENGNGNEEDAAFVQLWNIYLSTGRGEDAS 358 Query: 181 RIRKMMGDKGIKKTPGCSVVEVNGKVNEFIAGDAAH 288 +I +++G++G+KKTPGCS++EVNG VNEF++GD ++ Sbjct: 359 KIHRLIGERGLKKTPGCSMIEVNGMVNEFVSGDVSN 394 >emb|CBI35029.3| unnamed protein product [Vitis vinifera] Length = 1596 Score = 123 bits (309), Expect = 1e-26 Identities = 56/100 (56%), Positives = 76/100 (76%) Frame = +1 Query: 7 SVWGSMLSACNIHRNVEFAELAVEKLLQLEHDNGAEEDVTYVQLSNIYLNAQRSDDARRI 186 +VWG++LS C H NV+ AELA +LL + + +G EED YVQLSNIYL AQ+ +DA RI Sbjct: 379 AVWGALLSGCRTHNNVDLAELAARELLMVGNGDGTEEDGAYVQLSNIYLAAQKCEDACRI 438 Query: 187 RKMMGDKGIKKTPGCSVVEVNGKVNEFIAGDAAHPLQIEI 306 R+M+GDK IK PGCS++EV G+VN+F++GD +HP +I Sbjct: 439 RRMIGDKRIKTKPGCSLIEVEGEVNQFVSGDISHPCLAQI 478 >ref|XP_002276684.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g28640-like [Vitis vinifera] Length = 511 Score = 123 bits (309), Expect = 1e-26 Identities = 56/100 (56%), Positives = 76/100 (76%) Frame = +1 Query: 7 SVWGSMLSACNIHRNVEFAELAVEKLLQLEHDNGAEEDVTYVQLSNIYLNAQRSDDARRI 186 +VWG++LS C H NV+ AELA +LL + + +G EED YVQLSNIYL AQ+ +DA RI Sbjct: 379 AVWGALLSGCRTHNNVDLAELAARELLMVGNGDGTEEDGAYVQLSNIYLAAQKCEDACRI 438 Query: 187 RKMMGDKGIKKTPGCSVVEVNGKVNEFIAGDAAHPLQIEI 306 R+M+GDK IK PGCS++EV G+VN+F++GD +HP +I Sbjct: 439 RRMIGDKRIKTKPGCSLIEVEGEVNQFVSGDISHPCLAQI 478 >ref|XP_002877120.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322958|gb|EFH53379.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 399 Score = 115 bits (287), Expect = 5e-24 Identities = 52/102 (50%), Positives = 74/102 (72%) Frame = +1 Query: 1 LTSVWGSMLSACNIHRNVEFAELAVEKLLQLEHDNGAEEDVTYVQLSNIYLNAQRSDDAR 180 L SVWG++L+ C H+NVE ELAV+ LL LE N EE+ VQLSNIY + QR+ +A Sbjct: 283 LASVWGALLNGCRTHKNVELGELAVKNLLDLEKGNAEEEEAALVQLSNIYFSVQRNPEAS 342 Query: 181 RIRKMMGDKGIKKTPGCSVVEVNGKVNEFIAGDAAHPLQIEI 306 ++R M+ +GI+KTPG SV+EV+G V +F++GD +HP ++I Sbjct: 343 KVRGMIEQRGIRKTPGWSVLEVDGNVTKFVSGDVSHPNLLQI 384 >ref|XP_003533068.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Glycine max] Length = 712 Score = 114 bits (284), Expect = 1e-23 Identities = 52/99 (52%), Positives = 75/99 (75%) Frame = +1 Query: 10 VWGSMLSACNIHRNVEFAELAVEKLLQLEHDNGAEEDVTYVQLSNIYLNAQRSDDARRIR 189 VWGS+L AC +H+NV+ AE+A +++L+LE +NGA YV L NIY +R ++ R++R Sbjct: 511 VWGSLLGACRVHKNVQLAEMAAKQILELEPENGA----VYVLLCNIYAACKRWENLRQVR 566 Query: 190 KMMGDKGIKKTPGCSVVEVNGKVNEFIAGDAAHPLQIEI 306 K+M ++GIKKTPGCS++E+NG V EF+AGD +HP EI Sbjct: 567 KLMMERGIKKTPGCSLMELNGNVYEFVAGDQSHPQSKEI 605