BLASTX nr result
ID: Aconitum21_contig00023600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00023600 (446 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527228.1| mads box protein, putative [Ricinus communis... 56 3e-06 ref|XP_002302361.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002527228.1| mads box protein, putative [Ricinus communis] gi|223533404|gb|EEF35154.1| mads box protein, putative [Ricinus communis] Length = 173 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +1 Query: 10 MKSVIERYNKTKEEHHQLLNPTSEVKVSLRTNIIIQPSSNTICESN 147 MKS+IERYNKTKEEH QLLNPTSEVK R +++ + + ES+ Sbjct: 1 MKSIIERYNKTKEEHQQLLNPTSEVKFWQREAAVLRQQLHNLQESH 46 >ref|XP_002302361.1| predicted protein [Populus trichocarpa] gi|222844087|gb|EEE81634.1| predicted protein [Populus trichocarpa] Length = 228 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +1 Query: 7 SMKSVIERYNKTKEEHHQLLNPTSEVKVSLRTNIIIQPSSNTICESN 147 SMKSVIERYNK+K+EHHQ+ NPTSEVK R +++ T+ E++ Sbjct: 61 SMKSVIERYNKSKDEHHQMGNPTSEVKFWQREAAVLRQQLQTLQENH 107