BLASTX nr result
ID: Aconitum21_contig00023590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00023590 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315954.1| lysine/histidine transporter [Populus tricho... 75 4e-12 ref|XP_002311447.1| lysine/histidine transporter [Populus tricho... 75 4e-12 gb|AEE98384.1| LHT-type plant amino acid transporter 1.2 [Lotus ... 73 3e-11 dbj|BAK05191.1| predicted protein [Hordeum vulgare subsp. vulgare] 72 5e-11 ref|XP_004158062.1| PREDICTED: lysine histidine transporter 1-li... 72 6e-11 >ref|XP_002315954.1| lysine/histidine transporter [Populus trichocarpa] gi|222864994|gb|EEF02125.1| lysine/histidine transporter [Populus trichocarpa] Length = 423 Score = 75.5 bits (184), Expect = 4e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 410 FAPTSYFLPCIMWLAIKKPERFSRSWVVNWACIVAGTFIM 291 FAPTSYFLPC+MWL IKKP+RFS W +NWACI G FIM Sbjct: 362 FAPTSYFLPCVMWLLIKKPKRFSTKWFINWACIFVGVFIM 401 >ref|XP_002311447.1| lysine/histidine transporter [Populus trichocarpa] gi|222851267|gb|EEE88814.1| lysine/histidine transporter [Populus trichocarpa] Length = 435 Score = 75.5 bits (184), Expect = 4e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 410 FAPTSYFLPCIMWLAIKKPERFSRSWVVNWACIVAGTFIM 291 FAPTSYFLPC+MWL IKKP+RFS W +NWACI G FIM Sbjct: 374 FAPTSYFLPCVMWLIIKKPKRFSTKWFINWACIFVGVFIM 413 >gb|AEE98384.1| LHT-type plant amino acid transporter 1.2 [Lotus japonicus] Length = 466 Score = 72.8 bits (177), Expect = 3e-11 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 410 FAPTSYFLPCIMWLAIKKPERFSRSWVVNWACIVAGTFIM 291 FAPT+YFLPCIMWLAIKKP+ FS SW++NW CI+ G +M Sbjct: 405 FAPTTYFLPCIMWLAIKKPKMFSLSWIINWICIILGLLLM 444 >dbj|BAK05191.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 445 Score = 72.0 bits (175), Expect = 5e-11 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 410 FAPTSYFLPCIMWLAIKKPERFSRSWVVNWACIVAGTFI 294 FAPT+YFLPCIMWLAIKKP RFS SW +NW CI+ G + Sbjct: 384 FAPTTYFLPCIMWLAIKKPARFSMSWCINWVCIIIGVLL 422 >ref|XP_004158062.1| PREDICTED: lysine histidine transporter 1-like [Cucumis sativus] Length = 472 Score = 71.6 bits (174), Expect = 6e-11 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -2 Query: 410 FAPTSYFLPCIMWLAIKKPERFSRSWVVNWACIVAGTFIM 291 FAPT+Y+LPCIMWLAIKKP+R+S SW +NW CI+ G +M Sbjct: 386 FAPTTYYLPCIMWLAIKKPKRYSLSWFINWICIIIGVLLM 425