BLASTX nr result
ID: Aconitum21_contig00023534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00023534 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002297916.1| predicted protein [Populus trichocarpa] gi|2... 68 2e-13 ref|XP_004145209.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 >ref|XP_002297916.1| predicted protein [Populus trichocarpa] gi|222845174|gb|EEE82721.1| predicted protein [Populus trichocarpa] Length = 253 Score = 68.2 bits (165), Expect(2) = 2e-13 Identities = 42/99 (42%), Positives = 59/99 (59%), Gaps = 1/99 (1%) Frame = -2 Query: 425 EEVKKMHELLPRLCESNHLHEAIRXXXXXXXTNPPLESISDSLHILLHRLSEEPTMTQSM 246 EEV K++ L+PRLC NHL AI+ NPP +S+S S IL H L+ +P MT+ M Sbjct: 53 EEVTKINLLIPRLCLLNHLTTAIQLITTSLLANPPPKSLSFS--ILTHSLTSQPDMTKPM 110 Query: 245 SLLNRLKHS-GCPLFLPHITQLLIASYLNKKKFKEDISL 132 SLL L+H+ L + +LI SY+ KK+ KE + + Sbjct: 111 SLLTILRHTPQAHSHLSPMNTMLITSYIKKKRPKEALKV 149 Score = 32.0 bits (71), Expect(2) = 2e-13 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -3 Query: 157 RNSRKIFRWVSRPDSPCAAADMGVHARMLVKGLCENSLLRDVGWI 23 + + K++ W+ RP SPC + +LV GLCE +GW+ Sbjct: 144 KEALKVYNWMLRPGSPCKVEK--IVFCVLVNGLCE------IGWV 180 >ref|XP_004145209.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Cucumis sativus] gi|449471407|ref|XP_004153300.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Cucumis sativus] gi|449474047|ref|XP_004154059.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Cucumis sativus] gi|449503375|ref|XP_004161971.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Cucumis sativus] Length = 258 Score = 63.9 bits (154), Expect = 1e-08 Identities = 40/99 (40%), Positives = 56/99 (56%), Gaps = 1/99 (1%) Frame = -2 Query: 425 EEVKKMHELLPRLCESNHLHEAIRXXXXXXXTNPPLESISDSLHILLHRLSEEPTMTQSM 246 +E+ +++ LLPRLC NHL AI TNP L S+ SL +L H L+ + +M Sbjct: 58 DELTRINLLLPRLCLHNHLSTAISLLHATLLTNPSLHSL--SLSVLSHSLASQSDFALTM 115 Query: 245 SLLNRLK-HSGCPLFLPHITQLLIASYLNKKKFKEDISL 132 SLL RLK H L+ I +LI+SY ++K KE + L Sbjct: 116 SLLTRLKHHPNALLYSTPIVTMLISSYCKRRKSKEALKL 154