BLASTX nr result
ID: Aconitum21_contig00023519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00023519 (518 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313511.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_002313511.1| predicted protein [Populus trichocarpa] gi|222849919|gb|EEE87466.1| predicted protein [Populus trichocarpa] Length = 141 Score = 55.5 bits (132), Expect = 5e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -1 Query: 449 AQGRSPHGLAYQNPIPLSPSALEFFHPKSYD 357 AQGR+PHGL Y+NP+ SPSA+EFFHPK+++ Sbjct: 25 AQGRAPHGLVYENPVAFSPSAVEFFHPKTHE 55