BLASTX nr result
ID: Aconitum21_contig00021954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00021954 (560 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054501.1| hypothetical protein NitaCp025 [Nicotiana tabac... 57 3e-06 ref|YP_398865.1| hypothetical protein NitoCp030 [Nicotiana tomen... 56 3e-06 >ref|NP_054501.1| hypothetical protein NitaCp025 [Nicotiana tabacum] gi|78102537|ref|YP_358678.1| hypothetical protein NisyCp031 [Nicotiana sylvestris] gi|11835|emb|CAA77355.1| hypothetical protein [Nicotiana tabacum] gi|77799564|dbj|BAE46653.1| hypothetical protein [Nicotiana sylvestris] gi|225203|prf||1211235AH ORF 70A Length = 70 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = +3 Query: 174 KAKKESTV*VFQISR*KKRVRDAYIWGIYPSILNCGYINDRIIFDWTK 317 K KK++ + K R+ Y WGIYPSILNCG+ ND+IIFDWTK Sbjct: 19 KIKKKNRPFKYSKLNGKMAGRETYRWGIYPSILNCGFRNDKIIFDWTK 66 >ref|YP_398865.1| hypothetical protein NitoCp030 [Nicotiana tomentosiformis] gi|80750927|dbj|BAE48003.1| hypothetical protein [Nicotiana tomentosiformis] Length = 70 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = +3 Query: 174 KAKKESTV*VFQISR*KKRVRDAYIWGIYPSILNCGYINDRIIFDWTK 317 K KK++ + K R+ Y WGIYPSILNCG+ ND+IIFDWTK Sbjct: 19 KIKKKNRPFKYSKFNGKMAGRETYGWGIYPSILNCGFRNDKIIFDWTK 66