BLASTX nr result
ID: Aconitum21_contig00021446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00021446 (538 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB10385.1| unnamed protein product [Arabidopsis thaliana] 55 7e-06 >dbj|BAB10385.1| unnamed protein product [Arabidopsis thaliana] Length = 733 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -2 Query: 537 SNIVVKPPSYHARRGRPKKN-RIKEPGEVRVACNDSRATTKCTTCNGFGHNKKTC 376 S++VV PP GRPKKN RIK+P E + N +A C+ C GHNK+TC Sbjct: 616 SDVVVMPPPDRIMPGRPKKNDRIKDPSEEASSENSQKALVTCSNCGQIGHNKRTC 670