BLASTX nr result
ID: Aconitum21_contig00021294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00021294 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281033.1| PREDICTED: BEL1-like homeodomain protein 11 ... 59 3e-07 >ref|XP_002281033.1| PREDICTED: BEL1-like homeodomain protein 11 [Vitis vinifera] gi|302142555|emb|CBI19758.3| unnamed protein product [Vitis vinifera] Length = 470 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/59 (50%), Positives = 41/59 (69%) Frame = -3 Query: 178 SMTNQNIFEENDYLSYQSGRRNRNPLPQSLGGLPSIQSLEQHFSRSMELLQAPSLSEDS 2 S T+ N FE + + +Y S R N PQSLG LPSIQSL + SRS++L+QAP++ E+S Sbjct: 23 SFTSPNQFENHHFDAYGSHLRGSNTFPQSLGVLPSIQSLGERMSRSIDLVQAPAVGEES 81