BLASTX nr result
ID: Aconitum21_contig00021272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00021272 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267044.1| PREDICTED: 60S ribosomal protein L6, mitocho... 119 2e-25 emb|CAN72978.1| hypothetical protein VITISV_009029 [Vitis vinifera] 119 3e-25 ref|XP_002527470.1| 50S ribosomal protein L6, putative [Ricinus ... 116 2e-24 ref|XP_004143514.1| PREDICTED: 60S ribosomal protein L6, mitocho... 115 5e-24 ref|XP_003536284.1| PREDICTED: 60S ribosomal protein L6, mitocho... 114 6e-24 >ref|XP_002267044.1| PREDICTED: 60S ribosomal protein L6, mitochondrial [Vitis vinifera] gi|297735153|emb|CBI17515.3| unnamed protein product [Vitis vinifera] Length = 102 Score = 119 bits (299), Expect = 2e-25 Identities = 55/59 (93%), Positives = 59/59 (100%) Frame = -3 Query: 458 FLKIVGVGFKARAEAEGRLLYLKLGYSHEVELSVPPAVRVFCFKPNIVCCTGLDKQRVH 282 FLKIVGVGFKARAE+EGRLL+LKLGYSHEVEL+VPPAVRVFCFKPNIVCCTG+DKQRVH Sbjct: 8 FLKIVGVGFKARAESEGRLLFLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGIDKQRVH 66 >emb|CAN72978.1| hypothetical protein VITISV_009029 [Vitis vinifera] Length = 102 Score = 119 bits (298), Expect = 3e-25 Identities = 54/59 (91%), Positives = 59/59 (100%) Frame = -3 Query: 458 FLKIVGVGFKARAEAEGRLLYLKLGYSHEVELSVPPAVRVFCFKPNIVCCTGLDKQRVH 282 FLKIVGVGFKARAE+EGRLL+LKLGYSHEVEL+VPPAVRVFCFKPN+VCCTG+DKQRVH Sbjct: 8 FLKIVGVGFKARAESEGRLLFLKLGYSHEVELTVPPAVRVFCFKPNVVCCTGIDKQRVH 66 >ref|XP_002527470.1| 50S ribosomal protein L6, putative [Ricinus communis] gi|223533110|gb|EEF34868.1| 50S ribosomal protein L6, putative [Ricinus communis] Length = 102 Score = 116 bits (290), Expect = 2e-24 Identities = 53/59 (89%), Positives = 58/59 (98%) Frame = -3 Query: 458 FLKIVGVGFKARAEAEGRLLYLKLGYSHEVELSVPPAVRVFCFKPNIVCCTGLDKQRVH 282 FLKIVGVG+KARAE+EGRLLYLKLGYSHEVEL+VPPAVRVFCFK N+VCCTG+DKQRVH Sbjct: 8 FLKIVGVGYKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGIDKQRVH 66 >ref|XP_004143514.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Cucumis sativus] gi|449496483|ref|XP_004160146.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Cucumis sativus] Length = 102 Score = 115 bits (287), Expect = 5e-24 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -3 Query: 458 FLKIVGVGFKARAEAEGRLLYLKLGYSHEVELSVPPAVRVFCFKPNIVCCTGLDKQRVH 282 FLKIVGVG+KARAEA GRLLYLKLGYSHEVEL+VPPAVRVFCFK N+VCCTG+DKQRVH Sbjct: 8 FLKIVGVGYKARAEAAGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGIDKQRVH 66 >ref|XP_003536284.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Glycine max] Length = 102 Score = 114 bits (286), Expect = 6e-24 Identities = 52/59 (88%), Positives = 57/59 (96%) Frame = -3 Query: 458 FLKIVGVGFKARAEAEGRLLYLKLGYSHEVELSVPPAVRVFCFKPNIVCCTGLDKQRVH 282 FLKIVGVG+KARAEA GRLLYLKLGYSHEVEL+VPPAVRVFCFK N++CCTG+DKQRVH Sbjct: 8 FLKIVGVGYKARAEAAGRLLYLKLGYSHEVELAVPPAVRVFCFKNNVICCTGIDKQRVH 66