BLASTX nr result
ID: Aconitum21_contig00021121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00021121 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis th... 90 2e-16 ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis... 90 2e-16 dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana] 90 2e-16 gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana] 90 2e-16 ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containin... 89 3e-16 >ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana] gi|30686901|ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana] gi|110740537|dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana] gi|332005199|gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana] gi|332005200|gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana] Length = 708 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -3 Query: 408 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAATPRKP 274 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQS+ENRAATPRKP Sbjct: 661 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP 705 >ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319742|gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 709 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -3 Query: 408 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAATPRKP 274 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQS+ENRAATPRKP Sbjct: 662 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP 706 >dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana] Length = 708 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -3 Query: 408 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAATPRKP 274 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQS+ENRAATPRKP Sbjct: 661 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP 705 >gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana] Length = 708 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -3 Query: 408 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAATPRKP 274 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQS+ENRAATPRKP Sbjct: 661 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP 705 >ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] gi|449529842|ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] Length = 678 Score = 89.4 bits (220), Expect = 3e-16 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -3 Query: 408 QKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAATPRKPCQM 265 QKELHSTRGVLAGER+RAFQLQVEVFHLKQRLQSMENRA TPRKP M Sbjct: 631 QKELHSTRGVLAGERSRAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM 678