BLASTX nr result
ID: Aconitum21_contig00019171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00019171 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16897.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002278965.1| PREDICTED: protein NSP-INTERACTING KINASE 1 ... 58 7e-07 ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine ma... 57 2e-06 >emb|CBI16897.3| unnamed protein product [Vitis vinifera] Length = 622 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 337 WFILLSWFWVSSNGLLSPEGVNFEVQALMGI 429 WF+ WFW S+NGLLSP+GVNFEVQALMGI Sbjct: 9 WFVPFLWFWTSANGLLSPKGVNFEVQALMGI 39 >ref|XP_002278965.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera] Length = 624 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 337 WFILLSWFWVSSNGLLSPEGVNFEVQALMGI 429 WF+ WFW S+NGLLSP+GVNFEVQALMGI Sbjct: 11 WFVPFLWFWTSANGLLSPKGVNFEVQALMGI 41 >ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine max] gi|223452290|gb|ACM89473.1| NSP-interacting kinase [Glycine max] Length = 600 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 325 KAVLWFILLSWFWVSSNGLLSPEGVNFEVQALMGI 429 +A+L F+ WFW SSN LLSP+GVNFEVQALMGI Sbjct: 7 EAILCFLFFFWFWSSSNALLSPKGVNFEVQALMGI 41