BLASTX nr result
ID: Aconitum21_contig00019094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00019094 (440 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268571.2| PREDICTED: nicotinamide mononucleotide adeny... 236 1e-60 emb|CBI39745.3| unnamed protein product [Vitis vinifera] 236 1e-60 ref|XP_003617833.1| Nicotinamide mononucleotide adenylyltransfer... 226 1e-57 ref|XP_003544646.1| PREDICTED: nicotinamide mononucleotide adeny... 226 1e-57 ref|XP_003598151.1| Nicotinamide mononucleotide adenylyltransfer... 225 2e-57 >ref|XP_002268571.2| PREDICTED: nicotinamide mononucleotide adenylyltransferase 1-like [Vitis vinifera] Length = 254 Score = 236 bits (603), Expect = 1e-60 Identities = 109/143 (76%), Positives = 129/143 (90%) Frame = +1 Query: 4 MHLRMCELARDALNSDGYCVIGGFMSPVNDAYTKRGLISAKHRIQLCDLACKSSSFLTVD 183 MHLRM ELARDAL S+GYCVIGG+MSPVNDAY KRGLISA+HRIQ+CDLACKSS F+ VD Sbjct: 50 MHLRMFELARDALRSEGYCVIGGYMSPVNDAYKKRGLISAEHRIQMCDLACKSSEFIMVD 109 Query: 184 PWEAKQSSFQRTLTVLTRIQSFICESRMIPRESIRVVLVCGSDLLESFSVPGAWIPEQIR 363 PWEA QS+FQRTLTVL+RI+ +CE+ +IPRES++V+LVCGSDLLESF +PG WI EQ+ Sbjct: 110 PWEANQSTFQRTLTVLSRIKCSLCENGLIPRESLKVMLVCGSDLLESFGIPGFWITEQVM 169 Query: 364 AICRDHGVVCIRREGRDIESVIS 432 AICRD+GVVCIRREG+D+E +IS Sbjct: 170 AICRDYGVVCIRREGQDVEKIIS 192 >emb|CBI39745.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 236 bits (603), Expect = 1e-60 Identities = 109/143 (76%), Positives = 129/143 (90%) Frame = +1 Query: 4 MHLRMCELARDALNSDGYCVIGGFMSPVNDAYTKRGLISAKHRIQLCDLACKSSSFLTVD 183 MHLRM ELARDAL S+GYCVIGG+MSPVNDAY KRGLISA+HRIQ+CDLACKSS F+ VD Sbjct: 45 MHLRMFELARDALRSEGYCVIGGYMSPVNDAYKKRGLISAEHRIQMCDLACKSSEFIMVD 104 Query: 184 PWEAKQSSFQRTLTVLTRIQSFICESRMIPRESIRVVLVCGSDLLESFSVPGAWIPEQIR 363 PWEA QS+FQRTLTVL+RI+ +CE+ +IPRES++V+LVCGSDLLESF +PG WI EQ+ Sbjct: 105 PWEANQSTFQRTLTVLSRIKCSLCENGLIPRESLKVMLVCGSDLLESFGIPGFWITEQVM 164 Query: 364 AICRDHGVVCIRREGRDIESVIS 432 AICRD+GVVCIRREG+D+E +IS Sbjct: 165 AICRDYGVVCIRREGQDVEKIIS 187 >ref|XP_003617833.1| Nicotinamide mononucleotide adenylyltransferase [Medicago truncatula] gi|355519168|gb|AET00792.1| Nicotinamide mononucleotide adenylyltransferase [Medicago truncatula] Length = 251 Score = 226 bits (577), Expect = 1e-57 Identities = 104/146 (71%), Positives = 127/146 (86%) Frame = +1 Query: 1 YMHLRMCELARDALNSDGYCVIGGFMSPVNDAYTKRGLISAKHRIQLCDLACKSSSFLTV 180 +MHLRM ELARDALNS GYCVIGG+MSPVNDAY K+ LISA HRIQLC LACKSS F+ V Sbjct: 46 FMHLRMFELARDALNSKGYCVIGGYMSPVNDAYKKKNLISADHRIQLCHLACKSSEFVMV 105 Query: 181 DPWEAKQSSFQRTLTVLTRIQSFICESRMIPRESIRVVLVCGSDLLESFSVPGAWIPEQI 360 DPWEA Q+++QRTLTVL+R+ + ICE+ +I RES++V+LVCGSDLL SF +PG WIP+Q+ Sbjct: 106 DPWEANQNTYQRTLTVLSRVHASICETGLISRESLKVMLVCGSDLLHSFGIPGFWIPDQV 165 Query: 361 RAICRDHGVVCIRREGRDIESVISAD 438 ++ICRD+GVVCIRREG++IE IS D Sbjct: 166 KSICRDYGVVCIRREGQNIEKTISDD 191 >ref|XP_003544646.1| PREDICTED: nicotinamide mononucleotide adenylyltransferase 1-like [Glycine max] Length = 245 Score = 226 bits (576), Expect = 1e-57 Identities = 100/146 (68%), Positives = 128/146 (87%) Frame = +1 Query: 1 YMHLRMCELARDALNSDGYCVIGGFMSPVNDAYTKRGLISAKHRIQLCDLACKSSSFLTV 180 +MHLRM ELARDALNSDGYCVIGG++SPVNDAY K+GLISA+HRIQLC LACKSS F+ V Sbjct: 44 FMHLRMFELARDALNSDGYCVIGGYLSPVNDAYKKKGLISAEHRIQLCHLACKSSDFIMV 103 Query: 181 DPWEAKQSSFQRTLTVLTRIQSFICESRMIPRESIRVVLVCGSDLLESFSVPGAWIPEQI 360 DPWEA QS++QRTLTVL+R+ + +CE+ ++ +ES++V+L+CGSDLL SFS+PG WIP+Q+ Sbjct: 104 DPWEASQSTYQRTLTVLSRVHNSVCETGLVSQESLKVMLLCGSDLLHSFSIPGFWIPDQV 163 Query: 361 RAICRDHGVVCIRREGRDIESVISAD 438 + IC+D+GVVCI REG+D+E I D Sbjct: 164 KTICKDYGVVCIPREGQDVEKTIFKD 189 >ref|XP_003598151.1| Nicotinamide mononucleotide adenylyltransferase [Medicago truncatula] gi|355487199|gb|AES68402.1| Nicotinamide mononucleotide adenylyltransferase [Medicago truncatula] Length = 236 Score = 225 bits (574), Expect = 2e-57 Identities = 104/146 (71%), Positives = 126/146 (86%) Frame = +1 Query: 1 YMHLRMCELARDALNSDGYCVIGGFMSPVNDAYTKRGLISAKHRIQLCDLACKSSSFLTV 180 +MHLRM ELARDALNS GYCVIGG+MSPVNDAY K+ LISA HRIQLC LACKSS F+ V Sbjct: 29 FMHLRMFELARDALNSKGYCVIGGYMSPVNDAYKKKNLISADHRIQLCHLACKSSEFVMV 88 Query: 181 DPWEAKQSSFQRTLTVLTRIQSFICESRMIPRESIRVVLVCGSDLLESFSVPGAWIPEQI 360 DPWEA Q+++QRTLTVL R+ + ICE+ +I RES++V+LVCGSDLL SF +PG WIP+Q+ Sbjct: 89 DPWEANQNTYQRTLTVLFRVHASICETGLISRESLKVMLVCGSDLLHSFGIPGFWIPDQV 148 Query: 361 RAICRDHGVVCIRREGRDIESVISAD 438 ++ICRD+GVVCIRREG++IE IS D Sbjct: 149 KSICRDYGVVCIRREGQNIEKTISDD 174