BLASTX nr result
ID: Aconitum21_contig00018717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00018717 (530 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321534.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-10 ref|XP_002531199.1| Trigger factor, putative [Ricinus communis] ... 70 3e-10 ref|XP_004161884.1| PREDICTED: trigger factor-like protein TIG-l... 68 7e-10 ref|XP_004149343.1| PREDICTED: trigger factor-like protein TIG-l... 68 7e-10 ref|XP_003634717.1| PREDICTED: trigger factor isoform 2 [Vitis v... 67 2e-09 >ref|XP_002321534.1| predicted protein [Populus trichocarpa] gi|222868530|gb|EEF05661.1| predicted protein [Populus trichocarpa] Length = 528 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = +2 Query: 383 PELEKLPGDIEVIETKEASSRVRLNVKVPPVVCGDCYRRVLAEFTKQAK 529 P ++LP DI+V ET E +SR+RL+V+VPP VC DCY+RV+ EFTKQAK Sbjct: 68 PSNDRLPADIKVTETPEPNSRIRLSVEVPPAVCEDCYKRVMNEFTKQAK 116 >ref|XP_002531199.1| Trigger factor, putative [Ricinus communis] gi|223529201|gb|EEF31176.1| Trigger factor, putative [Ricinus communis] Length = 542 Score = 69.7 bits (169), Expect = 3e-10 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = +2 Query: 383 PELEKLPGDIEVIETKEASSRVRLNVKVPPVVCGDCYRRVLAEFTKQAK 529 PE +KLP DI+VIE++E +S +RL V+VPP VC DCY+RV+ EF KQAK Sbjct: 82 PEKDKLPADIKVIESQEPNSTLRLTVEVPPAVCDDCYKRVMNEFMKQAK 130 >ref|XP_004161884.1| PREDICTED: trigger factor-like protein TIG-like [Cucumis sativus] Length = 538 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = +2 Query: 383 PELEKLPGDIEVIETKEASSRVRLNVKVPPVVCGDCYRRVLAEFTKQAK 529 P+++KLP D+++ ET+E +S VRL+V VPP VC DC+RRV+AEF KQ K Sbjct: 79 PKIDKLPADLDISETEEPNSSVRLSVGVPPAVCEDCHRRVMAEFMKQVK 127 >ref|XP_004149343.1| PREDICTED: trigger factor-like protein TIG-like [Cucumis sativus] Length = 538 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = +2 Query: 383 PELEKLPGDIEVIETKEASSRVRLNVKVPPVVCGDCYRRVLAEFTKQAK 529 P+++KLP D+++ ET+E +S VRL+V VPP VC DC+RRV+AEF KQ K Sbjct: 79 PKIDKLPADLDISETEEPNSSVRLSVGVPPAVCEDCHRRVMAEFMKQVK 127 >ref|XP_003634717.1| PREDICTED: trigger factor isoform 2 [Vitis vinifera] Length = 491 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +2 Query: 392 EKLPGDIEVIETKEASSRVRLNVKVPPVVCGDCYRRVLAEFTKQAK 529 ++LP D+EV ET+E +SRVRL+V+VP VVC DCY+RV+ EFTK AK Sbjct: 79 DRLPADVEVTETEEPNSRVRLSVEVPAVVCEDCYQRVIREFTKLAK 124