BLASTX nr result
ID: Aconitum21_contig00018549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00018549 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527513.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002527513.1| conserved hypothetical protein [Ricinus communis] gi|223533153|gb|EEF34911.1| conserved hypothetical protein [Ricinus communis] Length = 197 Score = 57.0 bits (136), Expect = 2e-06 Identities = 37/102 (36%), Positives = 52/102 (50%) Frame = -1 Query: 319 MDGLLPYXXXXXXXXXXXKNFRSRSEGSTTARSYHLLIXXXXXXXXXXXSHRRTRSEFQP 140 M+GL+PY + ++S SEGS+ RSYHLLI HRRTRSEFQP Sbjct: 1 MEGLIPYILHAIKKQRPHRTYKSFSEGSS--RSYHLLIGSGDSINGSS--HRRTRSEFQP 56 Query: 139 PVFDYMEQRSGFDLHSRSLKFVDSHGLPAKQIGASNLRQAHK 14 P + +EQRS +L++V S L + + + + K Sbjct: 57 PAMELLEQRS-------ALEYVRSSSLRKRSVNSPTVASESK 91