BLASTX nr result
ID: Aconitum21_contig00018532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00018532 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003572128.1| PREDICTED: uncharacterized protein LOC100824... 55 6e-06 >ref|XP_003572128.1| PREDICTED: uncharacterized protein LOC100824920 [Brachypodium distachyon] Length = 132 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/62 (46%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Frame = +1 Query: 1 QRLSLGDMKKKLQQDDEADEE------GHHGHSFIRIEKSIHLIPILTLFCFLILYLFSH 162 QRLS+G + D A EE G G + + +KSIHL+P+LTL C L+L+LFSH Sbjct: 2 QRLSIGSPGASRPRLDAAAEEEDEKAAGKAGRAALAPDKSIHLVPLLTLLCLLVLFLFSH 61 Query: 163 DP 168 DP Sbjct: 62 DP 63