BLASTX nr result
ID: Aconitum21_contig00017684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00017684 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK00520.1| predicted protein [Hordeum vulgare subsp. vulgare] 106 2e-21 ref|XP_002265190.1| PREDICTED: AP-1 complex subunit gamma-2 [Vit... 104 9e-21 ref|XP_002521026.1| AP-1 complex subunit gamma-2, putative [Rici... 104 9e-21 gb|AAD14483.1| Strong similarity to gb|AF061286 gamma-adaptin 1 ... 103 2e-20 ref|XP_003561038.1| PREDICTED: AP-1 complex subunit gamma-2-like... 103 2e-20 >dbj|BAK00520.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 869 Score = 106 bits (265), Expect = 2e-21 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = +3 Query: 180 ELITSAFSSQTRLRDMIRAIRASKTAAEERAVVRKECAAIRASISDNYQDYRHRNLAKLM 359 +L + FSS TRLRDMIRAIRASKTAAEERAVVR+ECAAIRA+IS+N QDYRHRN+AKLM Sbjct: 2 DLSLNPFSSGTRLRDMIRAIRASKTAAEERAVVRRECAAIRAAISENDQDYRHRNMAKLM 61 Query: 360 FIHML 374 FIHML Sbjct: 62 FIHML 66 >ref|XP_002265190.1| PREDICTED: AP-1 complex subunit gamma-2 [Vitis vinifera] gi|296086533|emb|CBI32122.3| unnamed protein product [Vitis vinifera] Length = 878 Score = 104 bits (259), Expect = 9e-21 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = +3 Query: 198 FSSQTRLRDMIRAIRASKTAAEERAVVRKECAAIRASISDNYQDYRHRNLAKLMFIHML 374 FSS TRLRDMIRAIRA KTAAEERAVVRKECAAIRAS+S+N DYRHRNLAKLMFIHML Sbjct: 4 FSSGTRLRDMIRAIRACKTAAEERAVVRKECAAIRASVSENDHDYRHRNLAKLMFIHML 62 >ref|XP_002521026.1| AP-1 complex subunit gamma-2, putative [Ricinus communis] gi|223539863|gb|EEF41443.1| AP-1 complex subunit gamma-2, putative [Ricinus communis] Length = 875 Score = 104 bits (259), Expect = 9e-21 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = +3 Query: 198 FSSQTRLRDMIRAIRASKTAAEERAVVRKECAAIRASISDNYQDYRHRNLAKLMFIHML 374 FSS TRLRDMIRAIRA KTAAEERAVVRKECAAIRA+I++N QDYRHRNLAKLMFIHML Sbjct: 4 FSSGTRLRDMIRAIRACKTAAEERAVVRKECAAIRAAINENDQDYRHRNLAKLMFIHML 62 >gb|AAD14483.1| Strong similarity to gb|AF061286 gamma-adaptin 1 from Arabidopsis thaliana. EST gb|H37393 comes from this gene [Arabidopsis thaliana] Length = 867 Score = 103 bits (256), Expect = 2e-20 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = +3 Query: 198 FSSQTRLRDMIRAIRASKTAAEERAVVRKECAAIRASISDNYQDYRHRNLAKLMFIHML 374 FSS TRL DMIRAIRASKTAAEERAVVRKECAAIRASI++N QDYRHR+LAKLMFIHML Sbjct: 4 FSSGTRLSDMIRAIRASKTAAEERAVVRKECAAIRASINENDQDYRHRDLAKLMFIHML 62 >ref|XP_003561038.1| PREDICTED: AP-1 complex subunit gamma-2-like [Brachypodium distachyon] Length = 924 Score = 103 bits (256), Expect = 2e-20 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = +3 Query: 180 ELITSAFSSQTRLRDMIRAIRASKTAAEERAVVRKECAAIRASISDNYQDYRHRNLAKLM 359 +L + FSS TRLRDMIRAIRASKTA+EERAVVR+ECAAIRA+IS+ QDYRHRN+AKLM Sbjct: 56 DLSINPFSSGTRLRDMIRAIRASKTASEERAVVRRECAAIRAAISEGDQDYRHRNMAKLM 115 Query: 360 FIHML 374 FIHML Sbjct: 116 FIHML 120