BLASTX nr result
ID: Aconitum21_contig00016291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00016291 (461 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26264.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_002282622.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 >emb|CBI26264.3| unnamed protein product [Vitis vinifera] Length = 583 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 110 SSTVSPNYVTFVCVLSACSRAGSVEEGLEIFELMR 6 S V+PNYVTFVCVLSACSRAGSV G+EIFE MR Sbjct: 305 SHRVAPNYVTFVCVLSACSRAGSVNVGMEIFESMR 339 >ref|XP_002282622.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like [Vitis vinifera] Length = 684 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 110 SSTVSPNYVTFVCVLSACSRAGSVEEGLEIFELMR 6 S V+PNYVTFVCVLSACSRAGSV G+EIFE MR Sbjct: 406 SHRVAPNYVTFVCVLSACSRAGSVNVGMEIFESMR 440